Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Beta-1,4-mannosyltransferase egh (egh)

This Recombinant Drosophila melanogaster Beta-1,4-mannosyltransferase egh (egh) spans the amino acid sequence from region 1-457.

Product Specifications

Product Name Alternative

Beta-1,4-mannosyltransferase egh, EC= 2.4.1.-, Protein egghead, Protein zeste-white 4

UniProt

O01346

Expression Region

1-457

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTTKHLLHCTLLITVIVTFEVFSGGIKIDENSFTLVDPWTEYGQLATVLLYLLRFLTL LTLPQVLFNFCGLVFYNAFPEKVVLKGSPLLAPFICIRVVTRGDFPDLVKTNVLRNMNTC LDTGLENFLIEVVTDKAVNLSQHRRIREIVVPKEYKTRTGALFKSRALQYCLEDNVNVLN DSDWIVHLDEETLLTENSVRGIINFVLDGKHPFGQGLITYANENVVNWLTTLADSFRVSD DMGKLRLQFKLFHKPLFSWKGSYVVTQVSAERSVSFDNGIDGSVAEDCFFAMRAFSQGYT FNFIEGEMYEKSPFTLLDFLQQRKRWLQGILLVVHSKMIPFKHKLLLGISVYSWVTMPLS TSNIIFAALYPIPCPNLVDFVCAFIAAINIYMYVFGVIKSFSLYRFGLFRFLACVLGAVC TIPVNVVIENVAVIWGLVGKKHKFYVVQKDVRVLETV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOTCH4 Human shRNA Plasmid Kit (Locus ID 4855)
TL311138 1 Kit

NOTCH4 Human shRNA Plasmid Kit (Locus ID 4855)

Sign In for Pricing
View Details
C8orf86 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0264005 3x 1.0 µg

C8orf86 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
GeneGlide™ RNAi Delivery Control
M1082-100 100 µg

GeneGlide™ RNAi Delivery Control

Sign In for Pricing
View Details
Gm4981 Protein Vector (Mouse) (pPM-C-HA)
PV184188 500 ng

Gm4981 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
A Disintegrin And Metalloprotease 8 (ADAM8) Magnetic Fluorescence Assay Kit
MBS2155943-01 96 Tests

A Disintegrin And Metalloprotease 8 (ADAM8) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
A Disintegrin And Metalloprotease 8 (ADAM8) Magnetic Fluorescence Assay Kit
MBS2155943-02 5x 96 Tests

A Disintegrin And Metalloprotease 8 (ADAM8) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details