Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Beta-1,4-mannosyltransferase egh (egh)

This Recombinant Drosophila melanogaster Beta-1,4-mannosyltransferase egh (egh) spans the amino acid sequence from region 1-457.

Product Specifications

Product Name Alternative

Beta-1,4-mannosyltransferase egh, EC= 2.4.1.-, Protein egghead, Protein zeste-white 4

UniProt

O01346

Expression Region

1-457

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTTKHLLHCTLLITVIVTFEVFSGGIKIDENSFTLVDPWTEYGQLATVLLYLLRFLTL LTLPQVLFNFCGLVFYNAFPEKVVLKGSPLLAPFICIRVVTRGDFPDLVKTNVLRNMNTC LDTGLENFLIEVVTDKAVNLSQHRRIREIVVPKEYKTRTGALFKSRALQYCLEDNVNVLN DSDWIVHLDEETLLTENSVRGIINFVLDGKHPFGQGLITYANENVVNWLTTLADSFRVSD DMGKLRLQFKLFHKPLFSWKGSYVVTQVSAERSVSFDNGIDGSVAEDCFFAMRAFSQGYT FNFIEGEMYEKSPFTLLDFLQQRKRWLQGILLVVHSKMIPFKHKLLLGISVYSWVTMPLS TSNIIFAALYPIPCPNLVDFVCAFIAAINIYMYVFGVIKSFSLYRFGLFRFLACVLGAVC TIPVNVVIENVAVIWGLVGKKHKFYVVQKDVRVLETV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine STAT2 (Signal Transducer and Activator of Transcription 2) ELISA Kit
MBS2503673-01 24 Tests

Porcine STAT2 (Signal Transducer and Activator of Transcription 2) ELISA Kit

Sign In for Pricing
View Details
Porcine STAT2 (Signal Transducer and Activator of Transcription 2) ELISA Kit
MBS2503673-02 48 Tests

Porcine STAT2 (Signal Transducer and Activator of Transcription 2) ELISA Kit

Sign In for Pricing
View Details
Porcine STAT2 (Signal Transducer and Activator of Transcription 2) ELISA Kit
MBS2503673-03 96 Tests

Porcine STAT2 (Signal Transducer and Activator of Transcription 2) ELISA Kit

Sign In for Pricing
View Details
Porcine STAT2 (Signal Transducer and Activator of Transcription 2) ELISA Kit
MBS2503673-04 5x 96 Tests

Porcine STAT2 (Signal Transducer and Activator of Transcription 2) ELISA Kit

Sign In for Pricing
View Details
Porcine STAT2 (Signal Transducer and Activator of Transcription 2) ELISA Kit
MBS2503673-05 10x 96 Tests

Porcine STAT2 (Signal Transducer and Activator of Transcription 2) ELISA Kit

Sign In for Pricing
View Details
CD7 Antibody
orb44604 0.1 mg

CD7 Antibody

Sign In for Pricing
View Details