Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Beta-1,4-mannosyltransferase egh (egh)

This Recombinant Drosophila melanogaster Beta-1,4-mannosyltransferase egh (egh) spans the amino acid sequence from region 1-457.

Product Specifications

Product Name Alternative

Beta-1,4-mannosyltransferase egh, EC= 2.4.1.-, Protein egghead, Protein zeste-white 4

UniProt

O01346

Expression Region

1-457

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTTKHLLHCTLLITVIVTFEVFSGGIKIDENSFTLVDPWTEYGQLATVLLYLLRFLTL LTLPQVLFNFCGLVFYNAFPEKVVLKGSPLLAPFICIRVVTRGDFPDLVKTNVLRNMNTC LDTGLENFLIEVVTDKAVNLSQHRRIREIVVPKEYKTRTGALFKSRALQYCLEDNVNVLN DSDWIVHLDEETLLTENSVRGIINFVLDGKHPFGQGLITYANENVVNWLTTLADSFRVSD DMGKLRLQFKLFHKPLFSWKGSYVVTQVSAERSVSFDNGIDGSVAEDCFFAMRAFSQGYT FNFIEGEMYEKSPFTLLDFLQQRKRWLQGILLVVHSKMIPFKHKLLLGISVYSWVTMPLS TSNIIFAALYPIPCPNLVDFVCAFIAAINIYMYVFGVIKSFSLYRFGLFRFLACVLGAVC TIPVNVVIENVAVIWGLVGKKHKFYVVQKDVRVLETV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABA A Receptor gamma 2 Rabbit Polyclonal Antibody (FITC)
orb8139 100 µL

GABA A Receptor gamma 2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
KCNV1 Human Over-expression Lysate
orb1347966 100 µg

KCNV1 Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-LBP antibody
STJ119599 100 µl

Anti-LBP antibody

Sign In for Pricing
View Details
AP2A1, CT (AP2A1, ADTAA, CLAPA1, AP-2 complex subunit alpha-1, 100kD coated vesicle protein A, Adapter-related protein complex 2 alpha-1 subunit, Adaptor protein complex AP-2 subunit alpha-1, Alpha-adaptin A, Alpha1-adaptin, Clathrin assembly protein comp
MBS648675-01 0.2 mL

AP2A1, CT (AP2A1, ADTAA, CLAPA1, AP-2 complex subunit alpha-1, 100kD coated vesicle protein A, Adapter-related protein complex 2 alpha-1 subunit, Adaptor protein complex AP-2 subunit alpha-1, Alpha-adaptin A, Alpha1-adaptin, Clathrin assembly protein comp

Sign In for Pricing
View Details
AP2A1, CT (AP2A1, ADTAA, CLAPA1, AP-2 complex subunit alpha-1, 100kD coated vesicle protein A, Adapter-related protein complex 2 alpha-1 subunit, Adaptor protein complex AP-2 subunit alpha-1, Alpha-adaptin A, Alpha1-adaptin, Clathrin assembly protein comp
MBS648675-02 5x 0.2 mL

AP2A1, CT (AP2A1, ADTAA, CLAPA1, AP-2 complex subunit alpha-1, 100kD coated vesicle protein A, Adapter-related protein complex 2 alpha-1 subunit, Adaptor protein complex AP-2 subunit alpha-1, Alpha-adaptin A, Alpha1-adaptin, Clathrin assembly protein comp

Sign In for Pricing
View Details
Rabbit Anti-Human CREB1 pAb
PA5966-01 50 μL

Rabbit Anti-Human CREB1 pAb

Sign In for Pricing
View Details