Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 135 (Tmem135)

This Recombinant Mouse Transmembrane protein 135 (Tmem135) spans the amino acid sequence from region 1-458.

Product Specifications

Product Name Alternative

Transmembrane protein 135, Peroxisomal membrane protein 52, PMP52

UniProt

Q9CYV5

Expression Region

1-458

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAALSKSIPHNCYEIGHTWHPSCRVSFLQITWGALEESLRIYAPLYLIAAVLRKRKLEYY LYKLLPEILQSASFLTANGALYITFFCILRKILGKFYSWTPGFGAALPASYVAILIERKS RRGLLTIYMANLATETLFRMGVARGTITTLRNGEVLLFCITAAMYMFFFRCKDGLKGFTF SALRFIVGKEEIPTHSYSPETAYAKVEQKREKHKGTPRAMSIIALVRTLVDSVCKHGPRH RCCKHYEDNCISYCIKGFIRMFSVGYLIQCCLRIPSAFRHLFTEPSRLLSLFYNKENFQL GAFLGSFVSIYKGTSCFLRWIRNLDDELHAIVAGFLAGVSMMFYKSTTISMYLASKLVET MYFKGIEAGKVPYFPQADTIIYSISTAICFHAAVMEVQNLRPSYWKFLLRLTKGRFALMN RKALDVFGTGASREFHNFIPRLDPRYTVVTPELPIDFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HEATR3 activation kit by CRISPRa
GA110463 1 Kit

Human HEATR3 activation kit by CRISPRa

Sign In for Pricing
View Details
Human XKR5 activation kit by CRISPRa
GA118063 1 Kit

Human XKR5 activation kit by CRISPRa

Sign In for Pricing
View Details
C6orf114 Human qPCR Primer Pair (NM_033069)
HP216301 200 Reactions

C6orf114 Human qPCR Primer Pair (NM_033069)

Sign In for Pricing
View Details
C19orf50 (KXD1) Human Gene Knockout Kit (CRISPR)
KN400887 1 Kit

C19orf50 (KXD1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NUMB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G1]
TA802131AM 100 µL

NUMB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G1]

Sign In for Pricing
View Details
Human ARHGAP21 activation kit by CRISPRa
GA111610 1 Kit

Human ARHGAP21 activation kit by CRISPRa

Sign In for Pricing
View Details