Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II CP43 chlorophyll apoprotein (psbC)

This Recombinant Photosystem II CP43 chlorophyll apoprotein (psbC) spans the amino acid sequence from region 3-461.

Product Specifications

Product Name Alternative

Photosystem II CP43 chlorophyll apoprotein, PSII 43 kDa protein, Photosystem II 44 kDa reaction center protein, Protein CP-43, Protein P6

UniProt

P48104

Expression Region

3-461

Origin

Cyanophora paradoxa

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TLFNSSVAVSGRDQQSTGFAWWSGNARLINLSGKLLGAHVAHAGLIVFWTGAMTLFEVAH FIPEKPMYEQGLILLPHLATLGWGVGPGGEVIDVYPYFVVGVLHLVSSAVLGFGGLYHAI IGPEVLEESFPFFGYDWKDKNKMTTIIGIHLILLGSGALLLVLKAMFFGGVYDTWAPGGG DVRVISNPTLNPTVIFSYITKSPWGGDGWIVSVDNMEDIIGGHIWLAFICIIGGVWHILT KPFSWARRALVWSGEAYLSYSLAALALMGFIANCFVWFNNTAYPSEFFGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPSGEIIFGGETMRFWDTRAPWLEPLRGANG LDLTKIKYDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNYVSPRSWLSTSHFVLG FFLFIGHLWHAGRARAASGGFEKGLDRENEPVLSMKLLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHKA2 Protein Lysate (Human) with C-Ha Tag
36590031 100 µg

PHKA2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
PBK Rabbit Polyclonal Antibody (APC-Cy7)
orb2429107 100 µL

PBK Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Sheep ATP synthase protein 8 (MT ATP8) ELISA kit
GTR10379962 96 Well

Sheep ATP synthase protein 8 (MT ATP8) ELISA kit

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) ABCG49 Polyclonal Antibody
MBS7144714 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) ABCG49 Polyclonal Antibody

Sign In for Pricing
View Details
HDAC9 ELISA Kit (Human) (OKCD01849)
OKCD01849 96 Well

HDAC9 ELISA Kit (Human) (OKCD01849)

Sign In for Pricing
View Details
Rat C-PEPTIDE II Antibody
GWB-D3EE40 0.2 mg

Rat C-PEPTIDE II Antibody

Sign In for Pricing
View Details