Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nasturtium officinale Photosystem II CP43 chlorophyll apoprotein (psbC)

This Recombinant Nasturtium officinale Photosystem II CP43 chlorophyll apoprotein (psbC) spans the amino acid sequence from region 15-473.

Product Specifications

Product Name Alternative

Photosystem II CP43 chlorophyll apoprotein, PSII 43 kDa protein, Photosystem II 44 kDa reaction center protein, Protein CP-43, Protein P6

UniProt

A4QLS9

Expression Region

15-473

Origin

Nasturtium officinale (Water-cress) (Rorippa nasturtium-aquaticum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TLFNGTLALAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHAL LGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGVGAFLLVFKALYFGGVYDTWAPGGG DVRKITNLTLSPSVIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICIFGGIWHILT KPFAWARRALVWSGEAYLSYSLAALSVCGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNG LDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLSTSHFVLG FFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-100 1x 100 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-500 1x 500 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL/597), CF647 conjugate, 0.1mg/mL
BNC470597-100 1x 100 µL

Alkaline Phosphatase (ALPL/597), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-1 (SM1/495), CF647 conjugate, 0.1mg/mL
BNC470495-100 1x 100 µL

SUMO-1 (SM1/495), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T-Cell Leukemia Marker) (CD7/3737), CF740 conjugate, 0.1mg/mL
BNC742056-100 1x 100 µL

CD7 (T-Cell Leukemia Marker) (CD7/3737), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details