Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II CP43 chlorophyll apoprotein (psbC)

This Recombinant Photosystem II CP43 chlorophyll apoprotein (psbC) spans the amino acid sequence from region 3-461.

Product Specifications

Product Name Alternative

Photosystem II CP43 chlorophyll apoprotein, PSII 43 kDa protein, Photosystem II 44 kDa reaction center protein, Protein CP-43, Protein P6

UniProt

Q1KVY2

Expression Region

3-461

Origin

Scenedesmus obliquus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TLFNGTLTVGGRDQESTGFAWWAGNARLINLSGKLLGAHVAHAGLIVYWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGYGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGVYHSL IGPETLEESFPFFGYVWKDKNKMTNILGYHLIMLGIGAWLLVWKAMYFGGVYDTWAPGGG DVRIITNPTTNAAVVFGYLLKSPFGGDGWIVSVDNMEDIIGGHIWIGTLCILGGLWHIYT TPWPWARRAFVWSGEAYLSYSLGAISLMGFIACCMSWFNNTAYPSEFYGPTGPEASQSQA FTFLVRDQRLGANVASAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNG LDLNKLKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINAVNFVSPRSWLATSHFVLG FFFFVGHLWHAGRARAAAAGFEKGIDRLDEPVLSMRPLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMC2 Human Gene Knockout Kit (CRISPR)
KN418516 1 Kit

LAMC2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse Ceacam1 Protein (His Tag)
PDMM100233-01 20 µg

Recombinant Mouse Ceacam1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ceacam1 Protein (His Tag)
PDMM100233-02 100 µg

Recombinant Mouse Ceacam1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ceacam1 Protein (His Tag)
PDMM100233-03 500 µg

Recombinant Mouse Ceacam1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ceacam1 Protein (His Tag)
PDMM100233-04 1 mg

Recombinant Mouse Ceacam1 Protein (His Tag)

Sign In for Pricing
View Details
Sialoadhesin (SIGLEC1) (NM_023068) Human Recombinant Protein
TP324969 20 µg

Sialoadhesin (SIGLEC1) (NM_023068) Human Recombinant Protein

Sign In for Pricing
View Details