Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II CP43 chlorophyll apoprotein (psbC)

This Recombinant Photosystem II CP43 chlorophyll apoprotein (psbC) spans the amino acid sequence from region 30-488.

Product Specifications

Product Name Alternative

Photosystem II CP43 chlorophyll apoprotein, PSII 43 kDa protein, Photosystem II 44 kDa reaction center protein, Protein CP-43, Protein P6

UniProt

Q1XDD1

Expression Region

30-488

Origin

Porphyra yezoensis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TPFNTTVGVGGRDIESTGFAWWSGNARLINVSGKLLGAHVAHAGIMVFWTGAMTLFEVAH FVPEKPLYEQGFILIPHLATLGWGVGPGGEIFNTYPYFVVGVVHLISSAVLGFGGLYHSL IGPDTLEESFPFFGYDWRDKNKMTTILGIHLVLLGIGAFLLVIKALFIGGVYDTWAPGGG DVRFVSNPTLNPLVIFGYVLKSPFGGDGWIVSVNNMEDLVGGHVWIGIICIAGGIWHILT KPFAWARRAFVWSGEAYLSYSLGALSIMGLTASNFVWYNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVASSQGPTGLGKYLMRSPSGEIIFGGETMRFWDLRAPWVEPLRGPNG LDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNYVSPRSWLTTSHSFLG FFLFIGHLWHAGRARAAAAGFEKGINRENEPVLSMRPLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: A53-B/A2.26 + BA17]
AM50256PU-T 20 µg

Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: A53-B/A2.26 + BA17]

Sign In for Pricing
View Details
Tolylfluanide-d7 (Major)
TRC-T536732-1MG 1 mg

Tolylfluanide-d7 (Major)

Sign In for Pricing
View Details
FITC Anti-Mouse TER-119 Antibody[TER-119]
E-AB-F1125UC-01 25 µg

FITC Anti-Mouse TER-119 Antibody[TER-119]

Sign In for Pricing
View Details
FITC Anti-Mouse TER-119 Antibody[TER-119]
E-AB-F1125UC-02 100 µg

FITC Anti-Mouse TER-119 Antibody[TER-119]

Sign In for Pricing
View Details
Carbonic Anhydrase VIII (CPTC-CA8-2), CF568 conjugate, 0.1mg/mL
BNC682232-100 1x 100 µL

Carbonic Anhydrase VIII (CPTC-CA8-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LCK (NM_001042771) Human Over-expression Lysate
LY420808 100 µg

LCK (NM_001042771) Human Over-expression Lysate

Sign In for Pricing
View Details