Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Adiantum capillus-veneris Photosystem II CP43 chlorophyll apoprotein (psbC)

This Recombinant Adiantum capillus-veneris Photosystem II CP43 chlorophyll apoprotein (psbC) spans the amino acid sequence from region 15-473.

Product Specifications

Product Name Alternative

Photosystem II CP43 chlorophyll apoprotein, PSII 43 kDa protein, Photosystem II 44 kDa reaction center protein, Protein CP-43, Protein P6

UniProt

Q85FM3

Expression Region

15-473

Origin

Adiantum capillus-veneris (Maidenhair fern)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TLFNGTLSLGGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVSEKPMYEQGLILLPHLATLGWGVGPGGEVADTFPYFVSGVLHLISSAVLGFGGIYHAL IGPETLEESFPFFGYTWKDKNKMTTILGIHLILLGFGAFLLVFKALYFGGLYDTWAPGGG DVREITNLTLNPNIIFGYLLKSPFGGEGWIASVDNLEDIIGGHVWLGSICIFGGIWHILT KPFAWARRAFVWSGEAYLSYSLGALAIFGFTACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANIGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDLRAPWLEPLRGPNG LDLGKLKRDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLG FFFFVGHLWHAGRARAAAAGFEKGIDRDTEPVLSMTPLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-100 1x 100 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-500 1x 500 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL
BNC400003-100 1x 100 µL

CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-500 1x 500 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-500 1x 500 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10), CF640R conjugate, 0.1mg/mL
BNC400641-500 1x 500 µL

Chromogranin A (LK2H10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details