Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II CP43 chlorophyll apoprotein (psbC)

This Recombinant Photosystem II CP43 chlorophyll apoprotein (psbC) spans the amino acid sequence from region 15-473.

Product Specifications

Product Name Alternative

Photosystem II CP43 chlorophyll apoprotein, PSII 43 kDa protein, Photosystem II 44 kDa reaction center protein, Protein CP-43, Protein P6

UniProt

Q9MUW1

Expression Region

15-473

Origin

Mesostigma viride

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TLFNGTLSISGRDQESTGFAWWSGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FTPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGVYHSL IGPETLEESFPFFGYVWKDKNKMTTILGIHLIVLGVGAYLLVWKACYFGGVYDTWAPGGG DVRIITDPTLSPAVIFGYLLKSPFGGEGWICSVDNMEDVIGGHIWIGNLLIFGGIWHILT KPWAWARRAFVWSGEAYLSYSLGAIATMGWIACCFSWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANIASSQGPTGLGKYLMRSPSGEIIFGGETMRFWDCRAPWIEPLRGPNG LDLNKLKNDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNFVSPRSWLATSHFTLA FFFFVGHLWHAGRARAAAAGFEKGIERETEPVLFMKPLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Human Ig lambda chain-AbFluor 594
SA0867-01 100 µL

Anti Human Ig lambda chain-AbFluor 594

Sign In for Pricing
View Details
Anti Human Ig lambda chain-AbFluor 594
SA0867-02 1 mL

Anti Human Ig lambda chain-AbFluor 594

Sign In for Pricing
View Details
Tmem30a (NM_001004248) Rat Tagged ORF Clone Lentiviral Particle
RR211350L4V 200 µL

Tmem30a (NM_001004248) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal MGMT Antibody (OTI4F9) [DyLight 755]
NBP2-72659IR 0.1 mL

Mouse Monoclonal MGMT Antibody (OTI4F9) [DyLight 755]

Sign In for Pricing
View Details
Tmem50b Mouse Gene Knockout Kit (CRISPR)
KN517872 1 Kit

Tmem50b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CACNB4 (NM_000726) Human Tagged ORF Clone Lentiviral Particle
RC210440L2V 200 µL

CACNB4 (NM_000726) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details