Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Ferrous iron permease EfeU (efeU)

This Recombinant Bacillus subtilis Ferrous iron permease EfeU (efeU) spans the amino acid sequence from region 23-481.

Product Specifications

Product Name Alternative

Ferrous iron permease EfeU, Fe (2+) ion permease EfeU, Ferrous iron uptake protein

UniProt

P39595

Expression Region

23-481

Origin

Bacillus subtilis (strain 168)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EDDPIAALIQLNKQMIKSVKDGDMDSAQQTFDTFKAKWKKEEPSIKKENLSSHSEMDANI AMISLSFINQDARKLKTQLEELASHLETYQQAVVLKKTSSGQSRASLTAYIQSLKDTKQF IEKKQLDEASSAIDNLVTSWLAVEGDVVSQSKEAYTTSEENLALMKAEIGSHPEKVSKQI DEMIQLLEPIASSSYSWWDAALIPVREGMEALLVIGALLTMTKKARVTRSSTWIWGGASA GMAVSLAAGIGVTVLFSSSVFGENNFLLGGVTGVLSAVMLLYVGVWLHRNASMDKWREKI NIQKSQALKKRSLLSFALIAFLAVVREGLETVIFFIGLVGKLPLTELIGGTAAGLIVLVI VGVLMIKLGMRIPLKPFFLLSMAVVLYMCVKFLGTGVHSLQLAGILPSDAESWLPSVSVL GIYPSVYSTIPQMLILLFLLIALVSEAAKHFTNGKELTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (2755-8), CF568 conjugate, 0.1mg/mL
BNC680091-500 1x 500 µL

Fibronectin (2755-8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (N370S) (His Tag)
PKSV030438 100 µg

Recombinant SARS-CoV-2 Spike RBD (N370S) (His Tag)

Sign In for Pricing
View Details
TRRAP Human Gene Knockout Kit (CRISPR)
KN419527 1 Kit

TRRAP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
COG2 (NM_007357) Human Over-expression Lysate
LY402136 100 µg

COG2 (NM_007357) Human Over-expression Lysate

Sign In for Pricing
View Details
ROR2 Rabbit Monoclonal Antibody
TA423760 100 µL

ROR2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human GAGE10 activation kit by CRISPRa
GA119576 1 Kit

Human GAGE10 activation kit by CRISPRa

Sign In for Pricing
View Details