Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Zinc transporter 6 (Slc30a6)

This Recombinant Mouse Zinc transporter 6 (Slc30a6) spans the amino acid sequence from region 1-460.

Product Specifications

Product Name Alternative

Zinc transporter 6, ZnT-6, Solute carrier family 30 member 6

UniProt

Q8BJM5

Expression Region

1-460

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTIHLFRKPQRSFFGKLLQEFRLVAADRRSWKILLFGAINVLCTGFLLMWCSSTNSIAL TAYTYLTIFDLFSLITCLISYWVMMRKPSPVYSFGFERLEVLAVFASTVLAQLGALFILK ESAERFLEQPEIHTGRLLVGTFVALSFNLFTMLSIRNKPFAYVSEAASTSWLQEHVADLS RSLCGLIPGLSSIFLPRMNPFVLIDLAGAFALCITYMLIEINNYFAVDTASAIAIALMTF GTMYPMSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVH VRIRRDANEQMVLAHVSNRLCTLVSTLTVQIFKDDWIRPALSSGPVAPNVLNFSDHHVIP MPLLKNVDERTPVTSTPAKPSSPPPEFSFNTPGKNVSPVILLNTQTRPYSLGLNRGHTPY SSVFSQGLAFPGVGAGQGLRPTFPHIPSRYGINRMGQPRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human EXTL2 shRNA (UAS) - Lentiviral human EXTL2 shRNA (UAS) plasmid
GTR15140215 1 Vial

Lentiviral human EXTL2 shRNA (UAS) - Lentiviral human EXTL2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
GEMIN7 (gem (Nuclear organelle) Associated Protein 7, SIP3)
246554 50 µL

GEMIN7 (gem (Nuclear organelle) Associated Protein 7, SIP3)

Sign In for Pricing
View Details
CHO-K1/HEK293 Cells Stable expressing GPCR protein AVPR1B (Protein accession # NM_000707)
cAP-1047 1 Frozen Vial

CHO-K1/HEK293 Cells Stable expressing GPCR protein AVPR1B (Protein accession # NM_000707)

Sign In for Pricing
View Details
TRIM25 (Tripartite Motif-Containing 25, EFP, RNF147, Z147, ZNF147) (PE)
252988-PE 100 µL

TRIM25 (Tripartite Motif-Containing 25, EFP, RNF147, Z147, ZNF147) (PE)

Sign In for Pricing
View Details
SIRT1 Human Over-expression Lysate
orb1357113 100 µg

SIRT1 Human Over-expression Lysate

Sign In for Pricing
View Details
4930571K23RIK Adenovirus (Mouse)
10686054 1.0 mL

4930571K23RIK Adenovirus (Mouse)

Sign In for Pricing
View Details