Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides Sensor histidine kinase regB (regB)

This Recombinant Rhodobacter sphaeroides Sensor histidine kinase regB (regB) spans the amino acid sequence from region 1-462.

Product Specifications

Product Name Alternative

Sensor histidine kinase regB, EC= 2.7.13.3, Protein prrB

UniProt

Q3J6C1

Expression Region

1-462

Origin

Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MILGPDGILNRDTRGDWVRLRTLILLRWMAVAGQLAAIVVTDWYLGVRLPMGLCFMAVGA SVIANVIATFVFPQNRRLTEFQALMILLFDLTQLSFLLFLTGGLTNPFALLILAPVTISA LALELRTTVILGAIAIGLLTFTAYFHLPLILADGSSLSVPRMFEFGFWLAIVIGILFLGL YSRRVAIEIRSMSDALLATQMALDREQKLTDLGGVVAAAAHELGTPLATIKLVSSELAEE LSEQPALRDDAELIREQADRCRDILRSMGRAGKDDLQMRQAPLGEVLREAAEPHVGRGKR VEFDLYPSRGGDERQPVILRRPEVIHGLRNLIQNAVDFARSTVWIDGEWTGDRIAIRIVD DGEGYPPAIIGRIGDPFVRQRRAEESQSRRPGYEGMGLGLFIAKTLLERSGAELSFANAA DPFLRSHERPERCGAIVEVIWPVDRLVVVRNAPLGENVLIQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRS3 siRNA (m)
sc-145250 10 µM

FRS3 siRNA (m)

Sign In for Pricing
View Details
Monkey Soluble Vascular endothelial growth factor receptor 1 ELISA kit
GTR10451917 96 Well

Monkey Soluble Vascular endothelial growth factor receptor 1 ELISA kit

Sign In for Pricing
View Details
Phospho-Syk (Tyr323) Recombinant Antibody, PE-Cy7 Conjugated
bsm-62848R-PE-Cy7-TR 20 µL

Phospho-Syk (Tyr323) Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
POLD2 (DNA Polymerase delta Subunit 2, DNA Polymerase delta Subunit p50, POLD2) (MaxLight 490) discontinued
302655-ML490 100 µL

POLD2 (DNA Polymerase delta Subunit 2, DNA Polymerase delta Subunit p50, POLD2) (MaxLight 490) discontinued

Sign In for Pricing
View Details
KRG2/DDX11 Rabbit Polyclonal Antibody (BF555)
orb2390837 100 µL

KRG2/DDX11 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
PCAF Double Nickase Plasmid (h2)
sc-400753-NIC-2 20 µg

PCAF Double Nickase Plasmid (h2)

Sign In for Pricing
View Details