Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli PTS system mannitol-specific cryptic EIICB component (cmtA)

This Recombinant Escherichia coli PTS system mannitol-specific cryptic EIICB component (cmtA) spans the amino acid sequence from region 1-462.

Product Specifications

Product Name Alternative

PTS system mannitol-specific cryptic EIICB component, EIICB-Mtl, EII-Mtl, Including the following 2 domains:, Mannitol permease IIC component, PTS system mannito

UniProt

P69826

Expression Region

1-462

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENKSARAKVQAFGGFLTAMVIPNIGAFIAWGFITALFIPTGWLPNEHFAKIVGPMITYL LPVMIGSTGGHLVGGKRGAVMGGIGTIGVIVGAEIPMFLGSMIMGPLGGLVIKYVDKALE KRIPAGFEMVINNFSLGIAGMLLCLLGFEVIGPAVLIANTFVKECIEALVHAGYLPLLSV INEPAKVLFLNNAIDQGVYYPLGMQQASVNGKSIFFMVASNPGPGLGLLLAFTLFGKGMS KRSAPGAMIIHFLGGIHELYFPYVLMKPLTIIAMIAGGMSGTWMFNLLDGGLVAGPSPGS IFAYLALTPKGSFLATIAGVTVGTLVSFAITSLILKMEKTVETESEDEFAQSANAVKAMK QEGAFSLSRVKRIAFVCDAGMGSSAMGATTFRKRLEKAGLAIEVKHYAIENVPADADIVV THASLEGRVKRVTDKPLILINNYIGDPKLDTLFNQLTAEHKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Thrombospondin 1 Monoclonal Antibody
E-AB-81612-01 50 µL

Recombinant Thrombospondin 1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Thrombospondin 1 Monoclonal Antibody
E-AB-81612-02 100 µL

Recombinant Thrombospondin 1 Monoclonal Antibody

Sign In for Pricing
View Details
GPRC5C Antibody
8G319-AAT 50 µg

GPRC5C Antibody

Sign In for Pricing
View Details
COX5B Antibody
8C12238-AAT 50 µg

COX5B Antibody

Sign In for Pricing
View Details
Human ANKUB1 activation kit by CRISPRa
GA118032 1 Kit

Human ANKUB1 activation kit by CRISPRa

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823 + DCS-60.2), CF640R conjugate, 0.1mg/mL
BNC401135-500 1x 500 µL

P21 / WAF1 (CIP1/823 + DCS-60.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details