Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant PTS system mannitol-specific cryptic EIICB component (cmtA)

This Recombinant PTS system mannitol-specific cryptic EIICB component (cmtA) spans the amino acid sequence from region 1-462.

Product Specifications

Product Name Alternative

PTS system mannitol-specific cryptic EIICB component, EIICB-Mtl, EII-Mtl, Including the following 2 domains:, Mannitol permease IIC component, PTS system mannito

UniProt

P69827

Expression Region

1-462

Origin

Escherichia coli O157:H7

Field of Research

Stem Cell & Developmental Biology; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENKSARAKVQAFGGFLTAMVIPNIGAFIAWGFITALFIPTGWLPNEHFAKIVGPMITYL LPVMIGSTGGHLVGGKRGAVMGGIGTIGVIVGAEIPMFLGSMIMGPLGGLVIKYVDKALE KRIPAGFEMVINNFSLGIAGMLLCLLGFEVIGPAVLIANTFVKECIEALVHAGYLPLLSV INEPAKVLFLNNAIDQGVYYPLGMQQASVNGKSIFFMVASNPGPGLGLLLAFTLFGKGMS KRSAPGAMIIHFLGGIHELYFPYVLMKPLTIIAMIAGGMSGTWMFNLLDGGLVAGPSPGS IFAYLALTPKGSFLATIAGVTVGTLVSFAITSLILKMEKTVETESEDEFAQSANAVKAMK QEGAFSLSRVKRIAFVCDAGMGSSAMGATTFRKRLEKAGLAIEVKHYAIENVPADADIVV THASLEGRVKRVTDKPLILINNYIGDPKLDTLFNQLTAEHKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPARGC1A (Peroxisome Proliferator-Activated Receptor gamma, Coactivator 1 alpha, LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1) (MaxLight 650)
MBS6229356-01 0.1 mL

PPARGC1A (Peroxisome Proliferator-Activated Receptor gamma, Coactivator 1 alpha, LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1) (MaxLight 650)

Sign In for Pricing
View Details
PPARGC1A (Peroxisome Proliferator-Activated Receptor gamma, Coactivator 1 alpha, LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1) (MaxLight 650)
MBS6229356-02 5x 0.1 mL

PPARGC1A (Peroxisome Proliferator-Activated Receptor gamma, Coactivator 1 alpha, LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1) (MaxLight 650)

Sign In for Pricing
View Details
GJB6 Antibody - middle region : FITC (ARP36617_P050-FITC)
ARP36617_P050-FITC 100 µL

GJB6 Antibody - middle region : FITC (ARP36617_P050-FITC)

Sign In for Pricing
View Details
SAA2 Antibody, HRP conjugated
MBS7108997-01 0.05 mg

SAA2 Antibody, HRP conjugated

Sign In for Pricing
View Details
SAA2 Antibody, HRP conjugated
MBS7108997-02 0.1 mg

SAA2 Antibody, HRP conjugated

Sign In for Pricing
View Details
SAA2 Antibody, HRP conjugated
MBS7108997-03 5x 0.1 mg

SAA2 Antibody, HRP conjugated

Sign In for Pricing
View Details