Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant PTS system mannitol-specific cryptic EIICB component (cmtA)

This Recombinant PTS system mannitol-specific cryptic EIICB component (cmtA) spans the amino acid sequence from region 1-462.

Product Specifications

Product Name Alternative

PTS system mannitol-specific cryptic EIICB component, EIICB-Mtl, EII-Mtl, Including the following 2 domains:, Mannitol permease IIC component, PTS system mannito

UniProt

P69827

Expression Region

1-462

Origin

Escherichia coli O157:H7

Field of Research

Stem Cell & Developmental Biology; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENKSARAKVQAFGGFLTAMVIPNIGAFIAWGFITALFIPTGWLPNEHFAKIVGPMITYL LPVMIGSTGGHLVGGKRGAVMGGIGTIGVIVGAEIPMFLGSMIMGPLGGLVIKYVDKALE KRIPAGFEMVINNFSLGIAGMLLCLLGFEVIGPAVLIANTFVKECIEALVHAGYLPLLSV INEPAKVLFLNNAIDQGVYYPLGMQQASVNGKSIFFMVASNPGPGLGLLLAFTLFGKGMS KRSAPGAMIIHFLGGIHELYFPYVLMKPLTIIAMIAGGMSGTWMFNLLDGGLVAGPSPGS IFAYLALTPKGSFLATIAGVTVGTLVSFAITSLILKMEKTVETESEDEFAQSANAVKAMK QEGAFSLSRVKRIAFVCDAGMGSSAMGATTFRKRLEKAGLAIEVKHYAIENVPADADIVV THASLEGRVKRVTDKPLILINNYIGDPKLDTLFNQLTAEHKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Commd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4676208 1.0 µg DNA

Commd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
ELISA Kit for Coagulation Factor II (F2)
TRV-0038128-01 24 Tests

ELISA Kit for Coagulation Factor II (F2)

Sign In for Pricing
View Details
ELISA Kit for Coagulation Factor II (F2)
TRV-0038128-02 48 Tests

ELISA Kit for Coagulation Factor II (F2)

Sign In for Pricing
View Details
ELISA Kit for Coagulation Factor II (F2)
TRV-0038128-03 96 Tests

ELISA Kit for Coagulation Factor II (F2)

Sign In for Pricing
View Details
ELISA Kit for Coagulation Factor II (F2)
TRV-0038128-04 5x 96 Tests

ELISA Kit for Coagulation Factor II (F2)

Sign In for Pricing
View Details
ELISA Kit for Coagulation Factor II (F2)
TRV-0038128-05 10x 96 Tests

ELISA Kit for Coagulation Factor II (F2)

Sign In for Pricing
View Details