Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anaerolinea thermophila Protein translocase subunit SecD (secD)

This Recombinant Anaerolinea thermophila Protein translocase subunit SecD (secD) spans the amino acid sequence from region 1-464.

Product Specifications

Product Name Alternative

Protein translocase subunit SecD

UniProt

E8N5I8

Expression Region

1-464

Origin

Anaerolinea thermophila (strain DSM 14523 / JCM 11388 / NBRC 100420 / UNI-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRYYFTLALIVLLLGLTIWFNVPGHPQIKIGNFERSMDLIQGLDLQGGVQVLLEADLPA ETPIDPQALEDARTILENRTNALGVSENLFQVAGERRIVAEFPGLSDPEKVLAVIKETGL LEFVDLQDNPENLQEGNLILTDFGQTSTSTQPTETTTAPATEGQESLASTTVYHTIMTGK DLKSVVVSRNPNTGEVVIDFTLSDEGAKIFDEYTSNNIGKILAIVLDKKIISAPRVQGRI PSGQGQITGNFTLETANNLAIQMRYGALPIPFKVVESRVIGPTLGRDSLQKSLLAGYIGF TIVILFMGIYYRLPGVMADLSLIVYALITLTLFRFIPVTLTLPGIAGFLLSTGSALDANI LIFERLKEELRAGRTFSQALDLAWKRALPSIRDSNIATLITVVILFIFGSQFGATIVKGF AFTLGVGIFVSLFCAMVVTRTFMYILVDRMKPQAKHLKWFGILD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-100 1x 100 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF568 conjugate, 0.1mg/mL
BNC680322-100 1x 100 µL

CD3e (RIV9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5 + 123A8), CF405S conjugate, 0.1mg/mL
BNC040693-500 1x 500 µL

CD56 / NCAM (123C3.D5 + 123A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF488A conjugate, 0.1mg/mL
BNC881497-500 1x 500 µL

CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2590), CF594 conjugate, 0.1mg/mL
BNC942590-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/2590), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carbonic Anhydrase IX (CA9/781), CF647 conjugate, 0.1mg/mL
BNC470781-500 1x 500 µL

Carbonic Anhydrase IX (CA9/781), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details