Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Zinc transporter 6 (slc30a6)

This Recombinant Xenopus tropicalis Zinc transporter 6 (slc30a6) spans the amino acid sequence from region 1-464.

Product Specifications

Product Name Alternative

Zinc transporter 6, ZnT-6, Solute carrier family 30 member 6

UniProt

Q5I0B2

Expression Region

1-464

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTIYLFRKTQRSLLGKLTQEFRLVTADRRSWKILLFGAINVVCTGFLLTWCSSTNSMAL TAYTYLTIFDLFSLITCLISYWVMMKKPSPTYSFGFERFEVLSVFASTVLAQLGALFILK ESAERFVEQPEIHTGRLLVGTFVALCFNLFSMLSIRNKPFAYVSEAASTSWLQEHVADLS RSLCGIIPGLSSIFLPRMNPFVLIDIAGALALCITYMLIEINNYFAVDTASAIAIAVMTF GTMYPMSVYSGKVLLQTTPPHVIGQLDKLLREVSTLDGVLEVRNEHFWTLGFGTMAGSVH VRIRRDANEQMVLAHVTNRLNTLVSSLTVQIFKDEWARPVLASGAMPPNMLNIPDHHVIQ MPSLKSTMDELNPMTSTPSKPSSPPPEFAFNTPGKNMNPVILSNNQTRPSGVGFNYGTTP YTTTFNHGLGVPGIGNTQGLRTGLTNVANRYGTYTPGQFTQFKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-100 1x 100 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-100 1x 100 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
BNC040050-500 1x 500 µL

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF488A conjugate, 0.1mg/mL
BNC880861-500 1x 500 µL

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details