Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Calcium-binding mitochondrial carrier protein SCaMC-3 (Slc25a23)

This Recombinant Mouse Calcium-binding mitochondrial carrier protein SCaMC-3 (Slc25a23) spans the amino acid sequence from region 1-467.

Product Specifications

Product Name Alternative

Calcium-binding mitochondrial carrier protein SCaMC-3, Small calcium-binding mitochondrial carrier protein 3, Solute carrier family 25 member 23

UniProt

Q6GQS1

Expression Region

1-467

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRGGSSDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGRGDPDRAQQGVSSDWDAD PDGGLSLEEFTRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKI LHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSQEEKL TGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKSNRLNILGGLRNMIQEGGVLSL WRGNGINVLKIAPESAIKFMAYEQIKRAIRGQQETLHVQERFVAGSLAGATAQTIIYPME VLKTRLTLRRTGQYKGLLDCAKRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKN RWLQQYSHESANPGILVLLGCGTISSTCGQIASYPLALVRTRMQAQASIEGGPQVSMVGL LRHILSQEGVWGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
BNC040181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF488A conjugate, 0.1mg/mL
BNC880449-100 1x 100 µL

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF740 conjugate, 0.1mg/mL
BNC741045-500 1x 500 µL

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2387), CF647 conjugate, 0.1mg/mL
BNC472387-500 1x 500 µL

SOX9 / SRY-box 9 (SOX9/2387), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (LN-2 + CLIP/813), CF568 conjugate, 0.1mg/mL
BNC681207-100 1x 100 µL

CD74 (LN-2 + CLIP/813), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), 0.2mg/mL
BNUB0034-500 1x 500 µL

Cytokeratin 8/18 (C-51), 0.2mg/mL

Sign In for Pricing
View Details