Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Calcium-binding mitochondrial carrier protein SCaMC-2 (Slc25a25)

This Recombinant Rat Calcium-binding mitochondrial carrier protein SCaMC-2 (Slc25a25) spans the amino acid sequence from region 1-469.

Product Specifications

Product Name Alternative

Calcium-binding mitochondrial carrier protein SCaMC-2, Mitochondrial ATP-Mg/Pi carrier protein, Peroxisomal Ca (2+) -dependent solute carrier-like protein, Small calcium-binding mitochondrial carrier prote

UniProt

Q8K3P6

Expression Region

1-469

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLCLCLYVPIAGEAQTEFQYFESKGLPTELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGD KDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAE KILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEE RQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMCIIGGFTQMIREGGAK SLWRGNGINVLKIAPESAIKFMAYEQMKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYP MEVLKTRMALRKTGQYSGMLDCAKRILAKEGVAAFYKGYIPNMLGIIPYAGIDLAVYETL KNTWLQRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQAQASIEGAPEVTMS SLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL
BNC470276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
BNC740633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-100 1x 100 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL
BNC041037-100 1x 100 µL

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
BNC740676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-100 1x 100 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details