Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein translocase subunit SecF (secF)

This Recombinant Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-471.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

P38386

Expression Region

1-471

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSRAKVGAETTKGIDEPDRNDNTDDNGAGAVEVTEAAEDAVELTNDISTQLPQHGFLAR FYTGLSRLYTGTGVFEVVGRRRLWYSVGGVIVAVAVLSIIVRGFTFGIDFKGGTTVSMPV SPGVGGTGAIEVAQVADVFKKTLGSDPESVVVVGNGASATVRISSKTLSNDQTSKLRNAL FDAFGPKGADAKPSKQAISDAAVSETWGGQITKKVVIALVVFLVLVGLYITVRYERYMAI SALTTMCFDLTVTAGVYSLVGFEVTPATVIGLLTILGFSLYDTVIVFDKVEENTHGFQHT TRRTFAEQANLAINQTFMRSINTSLISVLPVLALMVVAVWLLGVGTLKDLALVQLVGIIV GTYSSIFFATPLLVTLRERTELVRTHTRRVVKRRTLGSQVGKKNADSHVAAGTRKPQNQA ESCADASSQEGTEVATASVPTVLSKLAPGVRPVRPTGTRRPTGKRNNVGRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Potassium voltage-gated channel subfamily KQT member 2, KCNQ2 ELISA Kit
MBS9325108-01 48 Well

Mouse Potassium voltage-gated channel subfamily KQT member 2, KCNQ2 ELISA Kit

Sign In for Pricing
View Details
Mouse Potassium voltage-gated channel subfamily KQT member 2, KCNQ2 ELISA Kit
MBS9325108-02 96 Well

Mouse Potassium voltage-gated channel subfamily KQT member 2, KCNQ2 ELISA Kit

Sign In for Pricing
View Details
Mouse Potassium voltage-gated channel subfamily KQT member 2, KCNQ2 ELISA Kit
MBS9325108-03 5x 96 Well

Mouse Potassium voltage-gated channel subfamily KQT member 2, KCNQ2 ELISA Kit

Sign In for Pricing
View Details
Mouse Potassium voltage-gated channel subfamily KQT member 2, KCNQ2 ELISA Kit
MBS9325108-04 10x 96 Well

Mouse Potassium voltage-gated channel subfamily KQT member 2, KCNQ2 ELISA Kit

Sign In for Pricing
View Details
NDUFS3 protein (His tag)
80R-2563 0.01 mg

NDUFS3 protein (His tag)

Sign In for Pricing
View Details
ZNF408 Polyclonal Antibody
E-AB-62523-01 60 µL

ZNF408 Polyclonal Antibody

Sign In for Pricing
View Details