Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Calcium-binding mitochondrial carrier protein SCaMC-1 (slc25a24)

This Recombinant Xenopus tropicalis Calcium-binding mitochondrial carrier protein SCaMC-1 (slc25a24) spans the amino acid sequence from region 1-473.

Product Specifications

Product Name Alternative

Calcium-binding mitochondrial carrier protein SCaMC-1, Small calcium-binding mitochondrial carrier protein 1, Solute carrier family 25 member 24

UniProt

Q5XHA0

Expression Region

1-473

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEQVQKFLLSRAACEGPDPHTRYAELFHKLDVNKDGKVDIVELQEGLKAMGMAVGKGAE EKIVAAGDTNKDGHLDFGEFIRYLEEHEKKMKIAFTSLDKNKDGKIESAEIMNSLKTLGI NISLEHAEKILKSMDADGTLTVDWNEWRDHFLFNPADNIQQIIRYWKHSTVLDIGDSLTI PDEFTEEEKKTGQWWKQLLAGGMAGAVSRTGTAPLDRLKVMMQVHGSKGNANIITGLKQM VKEGGIRSLWRGNGVNVIKIAPETAMKFWAYEQYKKLFTSESGKLGTAERFIAGSLAGAT AQTSIYPMEVLKTRLAVGKTGQYSGMFDCAKKIMQREGVRAFYKGYIPNILGIIPYAGID LAIYETLKTFWLQNYATDSANPGVLVLLGCGTASSTCGQLASYPLALIRTRMQAQASIEG APQLNMGGLFRKIVAKEGFFGLYRGIAPNFLKVLPAVSISYVVYEKMKIKLGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-500 1x 500 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-500 1x 500 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
BNC880029-100 1x 100 µL

Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL
BNC940525-100 1x 100 µL

CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (GA-5 + ASTRO/789), CF488A conjugate, 0.1mg/mL
BNC880898-500 1x 500 µL

GFAP (GA-5 + ASTRO/789), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details