Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Calcium-binding mitochondrial carrier protein SCaMC-1-B (slc25a24-b)

This Recombinant Xenopus laevis Calcium-binding mitochondrial carrier protein SCaMC-1-B (slc25a24-b) spans the amino acid sequence from region 1-473.

Product Specifications

Product Name Alternative

Calcium-binding mitochondrial carrier protein SCaMC-1-B, Small calcium-binding mitochondrial carrier protein 1-B, Solute carrier family 25 member 24-B

UniProt

Q7T0U6

Expression Region

1-473

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEQVQKFLLSRAACQGSDSQSRYEELFHKLDVNKDGKVDILELQEGLKAMGMEVGKGAE EKIVAAGDTNKDGHLDFGEFIRYLEEHEKKMKIAFTSLDKNKDGKIESAEIMNSLKVLGI KISLDHADKILKSMDSDGTLTVDWNEWRDHFLFNPADNIQQIIRYWKHSTVLDIGDSLTI PDEFTEEEKKTGQWWKQLMAGGMAGAVSRTGTAPLDRLKVMMQVHGSKGNSNIITGLKQM VKEGGIRSLWRGNGVNVIKIAPETAMKFWAYEQYKKLFTSESGKLGTAERFVAGSLAGAT AQTSIYPMEVLKTRLAVGRTGQYSGMFDCAKKIMQKEGIRAFYKGYIPNILGIIPYAGID LAIYETLKNYWLQNHAKDSANPGVLVLLGCGTASSTCGQLASYPLALIRTRMQAQASIEG APQLNMGGLFRKIVAKEGFLGLYRGIGPNFLKVLPAVSISYVVYEKMKVQLGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF740 conjugate, 0.1mg/mL
BNC740322-100 1x 100 µL

CD3e (RIV9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
BNC040218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-100 1x 100 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
BNC040226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-500 1x 500 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details