Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Calcium-binding mitochondrial carrier protein SCaMC-1 (Slc25a24)

This Recombinant Mouse Calcium-binding mitochondrial carrier protein SCaMC-1 (Slc25a24) spans the amino acid sequence from region 1-475.

Product Specifications

Product Name Alternative

Calcium-binding mitochondrial carrier protein SCaMC-1, Small calcium-binding mitochondrial carrier protein 1, Solute carrier family 25 member 24

UniProt

Q8BMD8

Expression Region

1-475

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRWLRAFVLPTAACHDAEPPTRYETLFRALDRNGDGVVDIGELQQGLQSLGIPLGQDAE EKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEPSEIVQSLQMLGL HISEKQAELILQSIDSDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTI PDEFTEDEKKSGQWWRQLLAGGVAGAVSRTSTAPLDRLKVMMQVHGSKSMNIFGGFRQMV KEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKLGTFERFISGSMAGATA QTFIYPMEVLKTRLAVAKTGQYSGIYGCAKKILKHEGFGAFYKGYIPNLLGIIPYAGIDL AVYELLKSYWLDNFAKDSVNPGVMVLLSCGALSSTCGQLASYPLALVRTRMQAQATVEGA PQLSMVGLFQRIVSKEGVSGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVAQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF488A conjugate, 0.1mg/mL
BNC880164-500 1x 500 µL

CD28 (204.12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-100 1x 100 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-100 1x 100 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5), CF647 conjugate, 0.1mg/mL
BNC470698-500 1x 500 µL

Chromogranin A (LK2H10 + PHE5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.10), CF740 conjugate, 0.1mg/mL
BNC740848-500 1x 500 µL

CD31 / PECAM-1 (C31.10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details