Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Spore germination protein A1 (gerAA)

This Recombinant Bacillus subtilis Spore germination protein A1 (gerAA) spans the amino acid sequence from region 1-482.

Product Specifications

Product Name Alternative

Spore germination protein A1

UniProt

P07868

Expression Region

1-482

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQTEFKEYIHDNLALVLPKLKENDDLVKNKKMLANGLVFYYLYFSEMTDENKVSEAIKT LIKDEETLTLDQVKKRLDQLDARPVETAKKTIESILNGNCAVFINGLDKAYILTTGKKKT RSLTEPTTEKVVRGPKVAFVEDIDTNLALIRQRTSHPKLITKKIMIGENKLKPAAIMYIE GKAKKSVIKEVKARLKNIQLEDIQDSGTLEELIEDNKYSPFPQIQNTERPDKVSSALFNG RVAILVDSSPFVLLVPVSLGILMQSPDDYYERWISASLIRSLRFASIFITLFLSSIYITL VSFHQGLLPTALAVTISANRENVPFPPIFEALLMEVTIELLREAGLRLPNPLGQTIGLVG GVVIGQAAVEANLVSSILVIVVSVIALASFTVPQYGMGLSFRVLRFISMFSAAILGLYGI ILFMLVVYTHLTRQTSFGSPYFSPNGFFSLKNTDDSIIRLPIKNKPKEVNNPNEPKTDST ET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse TATA Box Binding Protein Associated Factor 12 (TAF12) ELISA Kit
EKU07573-01 48 Tests

Mouse TATA Box Binding Protein Associated Factor 12 (TAF12) ELISA Kit

Sign In for Pricing
View Details
Mouse TATA Box Binding Protein Associated Factor 12 (TAF12) ELISA Kit
EKU07573-02 96 Tests

Mouse TATA Box Binding Protein Associated Factor 12 (TAF12) ELISA Kit

Sign In for Pricing
View Details
Mouse TATA Box Binding Protein Associated Factor 12 (TAF12) ELISA Kit
EKU07573-03 5x 96 Tests

Mouse TATA Box Binding Protein Associated Factor 12 (TAF12) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) TIF3 Polyclonal Antibody
MBS7139045 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) TIF3 Polyclonal Antibody

Sign In for Pricing
View Details
RAB27A Antibody
AM8511b 200 µL

RAB27A Antibody

Sign In for Pricing
View Details
Sulbactam Impurity 24
RM-S210224-01 10 mg

Sulbactam Impurity 24

Sign In for Pricing
View Details