Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Metalloreductase STEAP2 (Steap2)

This Recombinant Mouse Metalloreductase STEAP2 (Steap2) spans the amino acid sequence from region 1-489.

Product Specifications

Product Name Alternative

Metalloreductase STEAP2, EC= 1.16.1.-, Six-transmembrane epithelial antigen of prostate 2

UniProt

Q8BWB6

Expression Region

1-489

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESISMMGSPKSLETFLPNGINGIKDARQVTVGVIGSGDFAKSLTIRLIRCGYHVVIGSR NPKFASEFFPHVVDVTHHEDALTKTNIIFVAIHREHYTSLWDLRHLLVGKILIDVSNNMR VNQYPESNAEYLASLFPDSLIVKGFNVISAWALQLGPKDASRQVYICSNNIQARQQVIEL ARQLNFIPVDLGSLSSAKEIENLPLRLFTLWRGPVVVAISLATFFFLYSFVRDVIHPYAR NQQSDFYKIPIEIVNKTLPIVAITLLSLVYLAGLLAAAYQLYYGTKYRRFPPWLDTWLQC RKQLGLLSFFFAVVHVAYSLCLPMRRSERYLFLNMAYQQVHANIENAWNEEEVWRIEMYI SFGIMSLGLLSLLAVTSIPSVSNALNWREFSFIQSTLGYVALLITTFHVLIYGWKRAFAE EYYRFYTPPNFVLALVLPSIVILGKMILLLPCISRKLKRIKKGWEKSQFLDEGMGGAVPH LSPERVTVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

40mM dNTP Mix (10mM/20µmol each), 0.5ml
PR3040-M-1 1 Each

40mM dNTP Mix (10mM/20µmol each), 0.5ml

Sign In for Pricing
View Details
Human CD38 Antibody Pair Set
E-KAB-0700 50 µL & 100 µg

Human CD38 Antibody Pair Set

Sign In for Pricing
View Details
Il6ra Mouse Monoclonal Antibody [Clone ID: B-N12]
AM31173AF-N 200 µg

Il6ra Mouse Monoclonal Antibody [Clone ID: B-N12]

Sign In for Pricing
View Details
Collagen VII (LH7.2), CF640R conjugate, 0.1mg/mL
BNC402315-500 1x 500 µL

Collagen VII (LH7.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Human SLC (Secondary Lymphoid Tissue Chemokine) ELISA Kit
E-UNEL-H0398-01 5x 96 Tests

Uncoated Human SLC (Secondary Lymphoid Tissue Chemokine) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human SLC (Secondary Lymphoid Tissue Chemokine) ELISA Kit
E-UNEL-H0398-02 15x 96 Tests

Uncoated Human SLC (Secondary Lymphoid Tissue Chemokine) ELISA Kit

Sign In for Pricing
View Details