Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein translocase subunit SecD (secD)

This Recombinant Prochlorococcus marinus Protein translocase subunit SecD (secD) spans the amino acid sequence from region 1-494.

Product Specifications

Product Name Alternative

Protein translocase subunit SecD

UniProt

Q7VCH3

Expression Region

1-494

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARQQGWFALLIALVISAFLLCINLPFQLGLDLRGGSQLTLEVQALNPNEQIKSEQLEAV QSVLDRRVNGLGVAESSLRTIGTNQLILELPGEQEPSKAARVLGKTALLEFRKQKINTKS EMQRLQRIRSQVNNIDLYKKASKDNKSELIENKKIGEQVNDLRVALGLANSSLNEHDQID QIRQKVNSEIVELFEPSSLTGSDLVSAGRRQEQNLTSWEVTLAFNQDGGEKFASLTKSIA GSDRLLGIILDGESISEASVGEQFKVAGITGGSATISGNFTAESARELEVQLRGGSLPLP VSIVQVRTIGPTLGVDNIRRSLIAALLGLSLVAIFMVSFYRLAGFIAIFALSFYALFNIA IYALIPVTLTLPGVAGFVLSIGMAVDANVLIFERVKDELRRGNTLIRSIETGFSQAFSSI IDGHITTLISCISLFYLGTGFVKGFAATLGIGVFISLFTALSCTRVLLRFFMSYKSLRKT TNFLSENQLPKQLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MTX2 Protein, N-His
MBS1587244-01 0.1 mg

Recombinant Human MTX2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MTX2 Protein, N-His
MBS1587244-02 1 mg

Recombinant Human MTX2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MTX2 Protein, N-His
MBS1587244-03 5x 1 mg

Recombinant Human MTX2 Protein, N-His

Sign In for Pricing
View Details
PDZK1 Rabbit Polyclonal Antibody (Biotin)
orb2123641 100 µL

PDZK1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
PTK2B (Protein-tyrosine Kinase 2-beta, Calcium-dependent Tyrosine Kinase, CADTK, Cell Adhesion Kinase beta, CAK-beta, Focal Adhesion Kinase 2, FADK 2, Proline-rich Tyrosine Kinase 2, Related Adhesion Focal Tyrosine Kinase, RAFTK, FAK2, PYK2, RAFTK) (FITC)
132041-FITC 100 µL

PTK2B (Protein-tyrosine Kinase 2-beta, Calcium-dependent Tyrosine Kinase, CADTK, Cell Adhesion Kinase beta, CAK-beta, Focal Adhesion Kinase 2, FADK 2, Proline-rich Tyrosine Kinase 2, Related Adhesion Focal Tyrosine Kinase, RAFTK, FAK2, PYK2, RAFTK) (FITC)

Sign In for Pricing
View Details
3- ((4-methylphenyl) sulfonyl) -1- (2-phenylethyl) urea
BEA28936 250 mg

3- ((4-methylphenyl) sulfonyl) -1- (2-phenylethyl) urea

Sign In for Pricing
View Details