Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus furiosus Protein translocase subunit SecD (secD)

This Recombinant Pyrococcus furiosus Protein translocase subunit SecD (secD) spans the amino acid sequence from region 1-505.

Product Specifications

Product Name Alternative

Protein translocase subunit SecD

UniProt

Q8U4B4

Expression Region

1-505

Origin

Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKWRRILLNFRVIVLIFFLLISITALATRGLTFGLDISGGISITVKLEKPVDSQTMEQVK IALEQRLNTLGVKNIVVEPWGDQFVIVKVANVTEEEADQLIKTIERQGVFYAEFQGIIFA TGKDILNVGSVSYDPQHSAWVVPFRLSKEAAEKFAQLALGKAGYPVDMFLDPPVNSTLVV SNRVYEAMLSKTFMLEGDMTLVERIEKAFGIKVVPYANVTPEEIAEIAKGSERIILLDVD GNLSKALKEMGFEVETRSMRSDEDVYDFIKRSLGLYGPYRVSEGLATGNPSTEVMISITA PKTDIQARQDAQVVSVVLRSGSLPVKLSIERIDYISPKLGENFKRQVLVAGIAALLVVGL IVFLHYRKIKIAIPVMFTSFSEVLIILGIAALIRWNLDLPSIAGIIAAIGTGVDQQIVIT DELLGEEESRRRVKRSGVLRRMGRAFFIILASATTTIVAMSFLFKFFVGGLRGFAFTTIL GVLVGIFITRPAYGEIAKVLIGERR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rexo1 3'UTR Luciferase Stable Cell Line
TU117744 1.0 mL

Rexo1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
D9Ertd402e sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
17630114 3x 1.0 µg

D9Ertd402e sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
TSC22D3, ID (TSC22D3, DSIPI, GILZ, TSC22 domain family protein 3, DSIP-immunoreactive peptide, Delta sleep-inducing peptide immunoreactor, Glucocorticoid-induced leucine zipper protein, TSC-22-like protein, TSC-22-related protein) (PE) discontinued
043356-PE 200 µL

TSC22D3, ID (TSC22D3, DSIPI, GILZ, TSC22 domain family protein 3, DSIP-immunoreactive peptide, Delta sleep-inducing peptide immunoreactor, Glucocorticoid-induced leucine zipper protein, TSC-22-like protein, TSC-22-related protein) (PE) discontinued

Sign In for Pricing
View Details
PROX1 Protein Vector (Rat) (pPB-C-His)
PV296398 500 ng

PROX1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Cmtm1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7145605 3x 1.0 µg

Cmtm1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
T-Cell Differentiation Antigen CD6 (CD6) Antibody
abx421404-01 50 µg

T-Cell Differentiation Antigen CD6 (CD6) Antibody

Sign In for Pricing
View Details