Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Welwitschia mirabilis Photosystem II CP47 chlorophyll apoprotein (psbB)

This Recombinant Welwitschia mirabilis Photosystem II CP47 chlorophyll apoprotein (psbB) spans the amino acid sequence from region 1-508.

Product Specifications

Product Name Alternative

Photosystem II CP47 chlorophyll apoprotein, PSII 47 kDa protein, Protein CP-47

UniProt

B2Y1Y5

Expression Region

1-508

Origin

Welwitschia mirabilis (Tree tumbo) (Welwitschia bainesii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLPWYRVHTVVLNDPGRLIAVHIMHTALVAGWAGSMALYELAVFDPSDSVLDPMWRQGM FILPFMTRLGIKESWGGWSITGEPIANPGLWSYEGVAGAHIVFSGLCFLSATWHWVYWDL EIFSDPRTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPFGLTGKIQP VSPAWGAEGFDPFVPGGIASHHVAAGLLGIIAGLFHLSVRPPQRLYRGLRMGNIETVLSS SIAAVFFAAFIVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIDRRVQAGLAENLSLSE AWSRIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHPIFKDKEGNELFVRRMP TFFETFPVVLVDKEGVIKADIPFRRAESKYSVEQVGVTVEFYGGELNGVSFSDPAIVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDIFA GIDPELDIQVEFGAFQKIGDPTTKRQVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-100 1x 100 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Granulocyte Marker (BM-1), CF594 conjugate, 0.1mg/mL
BNC940061-100 1x 100 µL

Granulocyte Marker (BM-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), CF647 conjugate, 0.1mg/mL
BNC472564-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF488A conjugate, 0.1mg/mL
BNC881683-500 1x 500 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details