Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anthoceros formosae Photosystem II CP47 chlorophyll apoprotein (psbB)

This Recombinant Anthoceros formosae Photosystem II CP47 chlorophyll apoprotein (psbB) spans the amino acid sequence from region 1-508.

Product Specifications

Product Name Alternative

Photosystem II CP47 chlorophyll apoprotein, PSII 47 kDa protein, Protein CP-47

UniProt

Q85AI7

Expression Region

1-508

Origin

Anthoceros formosae (Hornwort)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLPWYRVHTVVLNDPGRLIAVHLMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITKSWGGWSITGETVTNAGIWSYEGVAAVHIVLSGLLFLAAIWHWVYWDL ELFRDERTGKPSLDLPKIFGIHLFLSGVLCFGFGAFHVTGLFGPGIWVSDPYGLTGKVEP VAPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKGLRMGNVETVLSS SIAAVFFAAFVVAGTMWYGSAATPIELFGPTRYQWDQGFFQQEIDRRIRSSKAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHAVFKDKEGHELFVRRMP TFFETFPVVLVDEEGIVRADIPFRRAESKYSVEQVGVIVEFYGGELDGVSFSDPVTVKKY ARRAQLGEIFEFDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDSDLDAQVEFGAFEKLGDPTTKRQVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL
BNC471073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-100 1x 100 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin Receptor (B6.2 + PRLR742), CF647 conjugate, 0.1mg/mL
BNC470744-500 1x 500 µL

Prolactin Receptor (B6.2 + PRLR742), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 / HCAM Std. (HCAM/2875R), CF568 conjugate, 0.1mg/mL
BNC682875-500 1x 500 µL

CD44 / HCAM Std. (HCAM/2875R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF740 conjugate, 0.1mg/mL
BNC741828-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details