Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Calcium-binding mitochondrial carrier protein SCaMC-2 (slc25a25)

This Recombinant Xenopus tropicalis Calcium-binding mitochondrial carrier protein SCaMC-2 (slc25a25) spans the amino acid sequence from region 1-513.

Product Specifications

Product Name Alternative

Calcium-binding mitochondrial carrier protein SCaMC-2, Small calcium-binding mitochondrial carrier protein 2, Solute carrier family 25 member 25

UniProt

Q5XH95

Expression Region

1-513

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARPRSLVSPLLSGVFCQCDTVGGAPHTHDTPASPSLAAALAADPCGGLVCGGPEHETRL QILFQELDVNKDGGICINDLAVGLKRLGVHRTELELRKIVKAGDKDQDGQLDFEEFVHYL RDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVNISEQQAEKILKSMDKNGTMTIDW NEWRDYHLLHPAENIPEIILYWKHSTIFDVGENLLVPDEFTVEEKQTGMWWRHLVAGGGA GAVSRTCTAPLDRLKVLMQVHASRSNNMSMLGGFTQMIREGGIRSLWRGNGINVIKIAPE SAIKFMAYEQMKRIIGSDQETLGIHERLVAGSLAGVIAQSSIYPMEVLKTRMALRKTGQY QGMLDCGKKILLKEGVSAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQRYATSSADPG VFVLLACGTISSTCGQLASYPLALVRTRMQAEASVEGAPQMTMSKLFKHIVKTEGAFGLY RGLAPNFMKVIPAVSISYVVYENLKLTLGVQSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
BNC471003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-500 1x 500 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-100 1x 100 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/1131), CF488A conjugate, 0.1mg/mL
BNC881131-500 1x 500 µL

CD45RA (PTPRC/1131), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta Catenin (p120) (Rabbit PAb), CF640R conjugate, 0.1mg/mL
BNC400376-100 1x 100 µL

Beta Catenin (p120) (Rabbit PAb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details