Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haloferax volcanii Protein translocase subunit SecD (secD)

This Recombinant Haloferax volcanii Protein translocase subunit SecD (secD) spans the amino acid sequence from region 1-524.

Product Specifications

Product Name Alternative

Protein translocase subunit SecD

UniProt

D4GTK5

Expression Region

1-524

Origin

Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLRDNWRVIFLVAAILLSTFALFSPTMGNQSPIGEDDSATNLQFGLQLDGGTRIRAPL VGVTAEDVEFEGDSERVVERQVAAQIAGADAADIIVRTGAESSTVEATIENVTADDLSAA LDAAGYAHGEVRDGVTGTTRAETVRVLQSKINEAGLSGGTVQQVTTATGEHFILVEVPNR DQSDVVDLVGERGTVQIDIYYPTGTDNGSRTYETREAVLTQADFTSIGTAQESQTGSGAF VPVSVRDDPAAEFQTAIQDTGLAQPGGTRCTYMEDGGRNTTEGCLLLVVNGEVVNAFGMS GGLADTMRAGEWAGAPSFQLQTRNTSEAQEIAINLRAGALPARLDLSGEDSGTSSYISPS QGESFKFDSLITGIVAVLAVAGVVFIRYGKPQVALPMIVTGLSEVYILLGFAAAIGYPLD LSVIAGFIAVIGTGVDDLIIIADEVMGEGSVKSRKVFQSRFRRAFWVIGAAAATTIIAMS PLAVLSLGDLQGFAIFTILGVIVGVLVTRPAYGDILRLLLTEDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-alpha B Crystallin (Ser45) Rabbit pAb
E47R12970 100 µL

Phospho-alpha B Crystallin (Ser45) Rabbit pAb

Sign In for Pricing
View Details
A-RAF, ID (Serine/Threonine-protein Kinase A-Raf, Proto-oncogene A-Raf-1, Proto-oncogene A-Raf, Proto-oncogene Pks, ARAF, ARAF1, PKS, PKS2) (APC) discontinued
R0495-05E-APC 200 µL

A-RAF, ID (Serine/Threonine-protein Kinase A-Raf, Proto-oncogene A-Raf-1, Proto-oncogene A-Raf, Proto-oncogene Pks, ARAF, ARAF1, PKS, PKS2) (APC) discontinued

Sign In for Pricing
View Details
CEP78 discontinued
387409 200 µL

CEP78 discontinued

Sign In for Pricing
View Details
Cytochrome P450 2D10 Rabbit pAb
E47R14180 100 µL

Cytochrome P450 2D10 Rabbit pAb

Sign In for Pricing
View Details
GLE1 (Nucleoporin GLE1, hGLE1, GLE1-like Protein, GLE1L) (MaxLight 650)
MBS6222363-01 0.1 mL

GLE1 (Nucleoporin GLE1, hGLE1, GLE1-like Protein, GLE1L) (MaxLight 650)

Sign In for Pricing
View Details
GLE1 (Nucleoporin GLE1, hGLE1, GLE1-like Protein, GLE1L) (MaxLight 650)
MBS6222363-02 5x 0.1 mL

GLE1 (Nucleoporin GLE1, hGLE1, GLE1-like Protein, GLE1L) (MaxLight 650)

Sign In for Pricing
View Details