Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haloferax volcanii Protein translocase subunit SecD (secD)

This Recombinant Haloferax volcanii Protein translocase subunit SecD (secD) spans the amino acid sequence from region 1-524.

Product Specifications

Product Name Alternative

Protein translocase subunit SecD

UniProt

D4GTK5

Expression Region

1-524

Origin

Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLRDNWRVIFLVAAILLSTFALFSPTMGNQSPIGEDDSATNLQFGLQLDGGTRIRAPL VGVTAEDVEFEGDSERVVERQVAAQIAGADAADIIVRTGAESSTVEATIENVTADDLSAA LDAAGYAHGEVRDGVTGTTRAETVRVLQSKINEAGLSGGTVQQVTTATGEHFILVEVPNR DQSDVVDLVGERGTVQIDIYYPTGTDNGSRTYETREAVLTQADFTSIGTAQESQTGSGAF VPVSVRDDPAAEFQTAIQDTGLAQPGGTRCTYMEDGGRNTTEGCLLLVVNGEVVNAFGMS GGLADTMRAGEWAGAPSFQLQTRNTSEAQEIAINLRAGALPARLDLSGEDSGTSSYISPS QGESFKFDSLITGIVAVLAVAGVVFIRYGKPQVALPMIVTGLSEVYILLGFAAAIGYPLD LSVIAGFIAVIGTGVDDLIIIADEVMGEGSVKSRKVFQSRFRRAFWVIGAAAATTIIAMS PLAVLSLGDLQGFAIFTILGVIVGVLVTRPAYGDILRLLLTEDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mup5 (NM_203325) Rat Tagged Lenti ORF Clone
RR201870L3 10 µg

Mup5 (NM_203325) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse CD218a/IL18R1 Protein, N-His
MBS1578400-01 0.1 mg

Recombinant Mouse CD218a/IL18R1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse CD218a/IL18R1 Protein, N-His
MBS1578400-02 1 mg

Recombinant Mouse CD218a/IL18R1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse CD218a/IL18R1 Protein, N-His
MBS1578400-03 5x 1 mg

Recombinant Mouse CD218a/IL18R1 Protein, N-His

Sign In for Pricing
View Details
MRPL20 Rabbit Polyclonal Antibody (HRP)
orb476904 100 µL

MRPL20 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Goat SAM pointed domain containing ets transcription factor (SPDE) ELISA Kit
EIA07744Go 1 Kit

Goat SAM pointed domain containing ets transcription factor (SPDE) ELISA Kit

Sign In for Pricing
View Details