Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cation channel sperm-associated protein 2 (CATSPER2)

This Recombinant Human Cation channel sperm-associated protein 2 (CATSPER2) spans the amino acid sequence from region 1-530.

Product Specifications

Product Name Alternative

Cation channel sperm-associated protein 2, CatSper2

UniProt

Q96P56

Expression Region

1-530

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAYQQEEQMQLPRADAIRSRLIDTFSLIEHLQGLSQAVPRHTIRELLDPSRQKKLVLGD QHQLVRFSIKPQRIEQISHAQRLLSRLHVRCSQRPPLSLWAGWVLECPLFKNFIIFLVFL NTIILMVEIELLESTNTKLWPLKLTLEVAAWFILLIFILEILLKWLSNFSVFWKSAWNVF DFVVTMLSLLPEVVVLVGVTGQSVWLQLLRICRVLRSLKLLAQFRQIQIIILVLVRALKS MTFLLMLLLIFFYIFAVTGVYVFSEYTRSPRQDLEYHVFFSDLPNSLVTVFILFTLDHWY ALLQDVWKVPEVSRIFSSIYFILWLLLGSIIFRSIIVAMMVTNFQNIRKELNEEMARREV QLKADMFKRQIIQRRKNMSHEALTSSHSKIEDSSRGASQQRESLDLSEVSEVESNYGATE EDLITSASKTEETLSKKREYQSSSCVSSTSSSYSSSSESRFSESIGRLDWETLVHENLPG LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLEDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VKORC1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2612305 3x 1.0 µg

VKORC1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit anti-human Transcription intermediary factor 1-beta polyclonal Antibody, HRP conjugated
MBS715816-01 0.05 mg

Rabbit anti-human Transcription intermediary factor 1-beta polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-human Transcription intermediary factor 1-beta polyclonal Antibody, HRP conjugated
MBS715816-02 0.1 mg

Rabbit anti-human Transcription intermediary factor 1-beta polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-human Transcription intermediary factor 1-beta polyclonal Antibody, HRP conjugated
MBS715816-03 5x 0.1 mg

Rabbit anti-human Transcription intermediary factor 1-beta polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
2- (Difluoromethoxy) -5-methoxybenzaldehyde
ULA86070-01 250 mg

2- (Difluoromethoxy) -5-methoxybenzaldehyde

Sign In for Pricing
View Details
2- (Difluoromethoxy) -5-methoxybenzaldehyde
ULA86070-02 2.5 g

2- (Difluoromethoxy) -5-methoxybenzaldehyde

Sign In for Pricing
View Details