Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lawsonia intracellularis Membrane protein insertase YidC (yidC)

This Recombinant Lawsonia intracellularis Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-532.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q1MPF3

Expression Region

1-532

Origin

Lawsonia intracellularis (strain PHE/MN1-00)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDKRIVLAIILSLVVFLGWHSFAEYMGWISPKVQHVANERHSSVDQTATSNIALDSVQS VFSPPTGKDVYIETPLYIAKIHSSGGILSSFILKKYKVNLDNTSPLVNLVSPEASQAMPL GITLNGQPSWSNGNWSFLGGDLYLKPGETKELTFVGIVNGVKIIRIFTFNADSYLIHEKL QLASEKQNSCPTKVGLLVAATPFGTGQYDPTRMAWSIKDSFKEETSIDTLKEKGIQESGE FNWGGVMSNYFMNVVALSDPLYLTIKGRIQNDVWRVALERSNVLIPAEGTTSITVNWWFG PKDRELLSRAPDKLENAIDFGMFSIIAKPLLTALTFFYEYTGNWGVAIIVLTLCIKIVFW PLSQKSYNSMEQMKKLQPMMQKLREKYANDRDTLNREIMQLYKTYKVNPAGGCLPILLQI PVFIGLYQALLNSIELRHATFIYYLPFTHLVWLADLSAADPFYITPLLMGASMFLQQKLT PASGDPTQQKIMMVMPIIFTVMFLNFPAGLVIYWLFNNLLSIGQQWWMLRKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
BNC040965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (TGB04 + TGB05), CF405S conjugate, 0.1mg/mL
BNC041227-100 1x 100 µL

Thyroglobulin (TGB04 + TGB05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL
BNC880679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-500 1x 500 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF640R conjugate, 0.1mg/mL
BNC402497-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details