Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Koribacter versatilis Protein translocase subunit SecD (secD)

This Recombinant Koribacter versatilis Protein translocase subunit SecD (secD) spans the amino acid sequence from region 1-535.

Product Specifications

Product Name Alternative

Protein translocase subunit SecD

UniProt

Q1IVE9

Expression Region

1-535

Origin

Koribacter versatilis (strain Ellin345)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKNLTWKVVVIVAVLLVFAFGIIGNPAEVKWDKEGLKTALMNRIHLGLDLRGGTHLILQ VVVNDAVNAETDRAIERIKEDLANNKVTYSDITKPDAANAPERIAIKGITPDGATTLRRV SDERLPEYSFGSGPEGSYTLTMKPAQLKDLKDRAVQQAIQKIRERVDSLGVSEPVIQEHG LGDYQILVQLPGVDDPARVKEVMQSTAMLEIRQVFGGPYSKESEAAQGQMQQPDTVVLPG KSESDPGTQVFYLVARSSAVAGHDLRQARVGRDQNGGANVQFNLTRDGGVRFSQFTSAHV GDKLGVILDGKVMEVANIKSEISDSGEIEGRFTDQQASDLALILNSGALPASIKYLEERT VGPSLGMDSIRQGVRAAIIGFVAVIIFMLIYYKGAGINADLSLLLNLVILLGFMGYFGAV LTLPGIAGVILTVGMGVDSNVLIFERIREELRNGKTPPSAVEQGFGHAWLTIIDTHVTTI VSAIILFLFGTGPVKGFAVTLSFGLFANLFTAVFVSRVIFDSILNRHQRGEALSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal GDAP1L1 Antibody (OTI1G5) [Alexa Fluor 350]
NBP2-72182AF350 0.1 mL

Mouse Monoclonal GDAP1L1 Antibody (OTI1G5) [Alexa Fluor 350]

Sign In for Pricing
View Details
BCORL2 3'UTR Luciferase Stable Cell Line
TU001719 1.0 mL

BCORL2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Cancer (Tumor) Cell Lines GSU
ARC1041 1 Million

Cancer (Tumor) Cell Lines GSU

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae waaE Protein (aa 1-258)
VAng-Cr5538-50gEcoli 50 µg (E. coli)

Recombinant Klebsiella Pneumoniae waaE Protein (aa 1-258)

Sign In for Pricing
View Details
Fam89b (NM_023166) Mouse Recombinant Protein
E45M48589M5 20 µg

Fam89b (NM_023166) Mouse Recombinant Protein

Sign In for Pricing
View Details
ATF3 (Activating Transcription Factor 3, ATF-3, Cyclic AMP-dependent Transcription Factor ATF-3, cAMP-dependent Transcription Factor ATF-3) (Biotin) discontinued
217193-Biotin 100 µL

ATF3 (Activating Transcription Factor 3, ATF-3, Cyclic AMP-dependent Transcription Factor ATF-3, cAMP-dependent Transcription Factor ATF-3) (Biotin) discontinued

Sign In for Pricing
View Details