Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella putrefaciens Membrane protein insertase YidC (yidC)

This Recombinant Shewanella putrefaciens Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-541.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

A4YCM2

Expression Region

1-541

Origin

Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESQRNILLIGLLFVSFLLWQQWQADKAPKPVATESSLVANVASTHSADVPEADTGVPAA VAASKNLITVKTDQLDVQINPVGGDIVFAALVSHKMEQGKEQPFVLLEQTKDYTYIAQSG LIGRDGIDSSANGRAAFTTSATEFTLAEGQDTLEVPLTYVADNGVTYTKVFVFHRGKFNV DVDYKINNTSAAPLQVQMYGQIKQTIKPSESSMMMPTYRGGAFSTNDVRYEKYNFDDMAK SNLNQATLGGWAAMLQHYFVSAWVPPATDSNTIFSSVSAGGLANIGFRGAVYDIAPGASQ EISSQFYVGPKDQAALSAISETLNLVVDYGFLWWLAVPIHWLLMFYQSFVGNWGVAIILI TLTVRGLLFPLTKAQYTSMAKMRNLQPKLADLKERFGDDRQKMGQAMMELYKKEKVNPMG GCLPIILQMPIFIALYWVLLESFELRHAPFMLWIHDLSVQDPYYILPLLMGVSMFIMQKM QPIAPTMDPMQVKMMQWMPVIFTVFFLWFPSGLVLYWLVGNIVAIIQQKIIYAGLEKKGL K

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XIAPC (APCI3, Baculoviral IAPC repeat-containing protein 4, BIRC4, hILP, HILP, IAPC3, IAPC-like protein, ILP1, Inhibitor of apoptosis protein 3, MIHA, Xiap, X-linked IAPC, X-linked inhibitor of apoptosis protein) (APC)
MBS6506269-01 0.1 mL

XIAPC (APCI3, Baculoviral IAPC repeat-containing protein 4, BIRC4, hILP, HILP, IAPC3, IAPC-like protein, ILP1, Inhibitor of apoptosis protein 3, MIHA, Xiap, X-linked IAPC, X-linked inhibitor of apoptosis protein) (APC)

Sign In for Pricing
View Details
XIAPC (APCI3, Baculoviral IAPC repeat-containing protein 4, BIRC4, hILP, HILP, IAPC3, IAPC-like protein, ILP1, Inhibitor of apoptosis protein 3, MIHA, Xiap, X-linked IAPC, X-linked inhibitor of apoptosis protein) (APC)
MBS6506269-02 5x 0.1 mL

XIAPC (APCI3, Baculoviral IAPC repeat-containing protein 4, BIRC4, hILP, HILP, IAPC3, IAPC-like protein, ILP1, Inhibitor of apoptosis protein 3, MIHA, Xiap, X-linked IAPC, X-linked inhibitor of apoptosis protein) (APC)

Sign In for Pricing
View Details
WATER250X26RL-T1-LL-P16 Pipe Markers for Water
N006352 30 Pack (30 Marker (s) x 1 Roll)

WATER250X26RL-T1-LL-P16 Pipe Markers for Water

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Glucose-6-phosphate isomerase (pgi)
MBS1167880-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O9:H4 Glucose-6-phosphate isomerase (pgi)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Glucose-6-phosphate isomerase (pgi)
MBS1167880-02 0.02 mg (Yeast)

Recombinant Escherichia coli O9:H4 Glucose-6-phosphate isomerase (pgi)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Glucose-6-phosphate isomerase (pgi)
MBS1167880-03 0.1 mg (E-Coli)

Recombinant Escherichia coli O9:H4 Glucose-6-phosphate isomerase (pgi)

Sign In for Pricing
View Details