Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelobacter propionicus Membrane protein insertase YidC (yidC)

This Recombinant Pelobacter propionicus Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-542.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

A1AV44

Expression Region

1-542

Origin

Pelobacter propionicus (strain DSM 2379)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKRTLLAVILSITVFYVFSLLFAPEKKPVQPESTGQAVSAPVSAGQPVAGGVQPSASAP SLPATAQQQDVTVRTGLYTAVFCSRGGALKSLTLKNYREKNLPDAQAVVLGSDADPSALT FSTRASGFNLPEGAPFVADATAVTMAGGEKKQLVFTHNSGQGFTVRKIYTFSGDSYGIKL DTQVFNNMAVPLVGTVQQVMTYPGLVKAKDSRFETAGSYLFSDNSLESDKLKDVSSASKL YDKNLQWSGFADKYFLTAILSEGGSIASVELRKNGAGFLESTVSSPRITVTPGQSVTVVH RLFVGPKDIDILKAQGNSLEQSLDLGWFTVIAKPLLYTLKYFYRYVGNYGVAIIIITIIL KALFFPLTHKSYKSMKDMQKIQPMMAALKEKYKDDREGMNKAVMELYRDHKVNPLGGCLP MLVQIPVFFALYKALMFSIELRHAPFYFWITDLSGPDNLFGQMLGLPFVIGPLPLLMGAT MFIQQKMTPSTMDPMQAKMMLALPVVFTFMFLNFPSGLVLYWLLNNILTIGQQMYINKLV ND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Insulin (PE) discontinued
I7656-05-PE 100 µL

Insulin (PE) discontinued

Sign In for Pricing
View Details
Porcine Elongation of Very Long Chain Fatty Acids Protein 7 (ELOVL7) ELISA Kit
MBS9396271-01 48 Well

Porcine Elongation of Very Long Chain Fatty Acids Protein 7 (ELOVL7) ELISA Kit

Sign In for Pricing
View Details
Porcine Elongation of Very Long Chain Fatty Acids Protein 7 (ELOVL7) ELISA Kit
MBS9396271-02 96 Well

Porcine Elongation of Very Long Chain Fatty Acids Protein 7 (ELOVL7) ELISA Kit

Sign In for Pricing
View Details
Porcine Elongation of Very Long Chain Fatty Acids Protein 7 (ELOVL7) ELISA Kit
MBS9396271-03 5x 96 Well

Porcine Elongation of Very Long Chain Fatty Acids Protein 7 (ELOVL7) ELISA Kit

Sign In for Pricing
View Details
Porcine Elongation of Very Long Chain Fatty Acids Protein 7 (ELOVL7) ELISA Kit
MBS9396271-04 10x 96 Well

Porcine Elongation of Very Long Chain Fatty Acids Protein 7 (ELOVL7) ELISA Kit

Sign In for Pricing
View Details
Chicken Dentin Matrix Protein 4 (FAM20C) ELISA Kit
MBS9398854 Inquire

Chicken Dentin Matrix Protein 4 (FAM20C) ELISA Kit

Sign In for Pricing
View Details