Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MARVEL domain-containing protein 2 (MARVELD2)

This Recombinant Human MARVEL domain-containing protein 2 (MARVELD2) spans the amino acid sequence from region 1-558.

Product Specifications

Product Name Alternative

MARVEL domain-containing protein 2, Tricellulin

UniProt

Q8N4S9

Expression Region

1-558

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNDGRSRNRDRRYDEVPSDLPYQDTTIRTHPTLHDSERAVSADPLPPPPLPLQPPFGPD FYSSDTEEPAIAPDLKPVRRFVPDSWKNFFRGKKKDPEWDKPVSDIRYISDGVECSPPAS PARPNHRSPLNSCKDPYGGSEGTFSSRKEADAVFPRDPYGSLDRHTQTVRTYSEKVEEYN LRYSYMKSWAGLLRILGVVELLLGAGVFACVTAYIHKDSEWYNLFGYSQPYGMGGVGGLG SMYGGYYYTGPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL FILYMAAAIVYVNDTNRGGLCYYPLFNTPVNAVFCRVEGGQIAAMIFLFVTMIVYLISAL VCLKLWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMK PELLSGHIPPGHIPKPIVMPDYVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVL RKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIK QRIQEYDKVMNWDVQGYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/CY7-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 8 (ADAM8)
MBS2045099-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 8 (ADAM8)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 8 (ADAM8)
MBS2045099-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 8 (ADAM8)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 8 (ADAM8)
MBS2045099-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 8 (ADAM8)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 8 (ADAM8)
MBS2045099-04 1 mL

APC/CY7-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 8 (ADAM8)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 8 (ADAM8)
MBS2045099-05 5 mL

APC/CY7-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 8 (ADAM8)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 8 (ADAM8)
MBS2045099-06 5x 5 mL

APC/CY7-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 8 (ADAM8)

Sign In for Pricing
View Details