Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Sensor protein lytS (lytS)

This Recombinant Staphylococcus aureus Sensor protein lytS (lytS) spans the amino acid sequence from region 1-584.

Product Specifications

Product Name Alternative

Sensor protein lytS, EC= 2.7.13.3, Autolysin sensor kinase

UniProt

P60614

Expression Region

1-584

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSLTMLLLERVGLIIILAYVLMNIPYFKNLMNRRRTWKARWQLCIIFSLFALMSNLTGI VIDHQHSLSGSVYFRLDDDVSLANTRVLTIGVAGLVGGPFVGLFVGVISGIFRVYMGGAD AQVYLISSIFIGIIAGYFGLQAQRRKRYPSIAKSAMIGIVMEMIQMLSILTFSHDKAYAV DLISLIALPMIIVNSVGTAIFMSIIISTLKQEEQMKAVQTHDVLQLMNQTLPYFKEGLNR ESAQQIAMIIKNLMKVSAVAITSKNEILSHVGAGSDHHIPTNEILTSLSKDVLKSGKLKE VHTKEEIGCSHPNCPLRAAIVIPLEMHGSIVGTLKMYFTNPNDLTFVERQLAEGLANIFS SQIELGEAETQSKLLKDAEIKSLQAQVSPHFFFNSINTISALVRINSEKARELLLELSYF FRANLQGSKQHTITLDKELSQVRAYLSLEQARYPGRFNININVEDKYRDVLVPPFLIQIL VENAIKHAFTNRKQGNDIDVSVIKETATHVRIIVQDNGQGISKDKMHLLGETSVESESGT GSALENLNLRLKGLFGKSAALQFESTSSGTTFWCVLPYERQEEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken ATP-binding cassette sub-family D member 2 (ABCD2) ELISA Kit
MBS7221752-01 48 Well

Chicken ATP-binding cassette sub-family D member 2 (ABCD2) ELISA Kit

Sign In for Pricing
View Details
Chicken ATP-binding cassette sub-family D member 2 (ABCD2) ELISA Kit
MBS7221752-02 96 Well

Chicken ATP-binding cassette sub-family D member 2 (ABCD2) ELISA Kit

Sign In for Pricing
View Details
Chicken ATP-binding cassette sub-family D member 2 (ABCD2) ELISA Kit
MBS7221752-03 5x 96 Well

Chicken ATP-binding cassette sub-family D member 2 (ABCD2) ELISA Kit

Sign In for Pricing
View Details
Chicken ATP-binding cassette sub-family D member 2 (ABCD2) ELISA Kit
MBS7221752-04 10x 96 Well

Chicken ATP-binding cassette sub-family D member 2 (ABCD2) ELISA Kit

Sign In for Pricing
View Details
KLF9, NT (KLF9, BTEB, BTEB1, Krueppel-like factor 9, GC-box-binding protein 1, Basic transcription element-binding protein 1, Transcription factor BTEB1)
MBS645107-01 0.2 mL

KLF9, NT (KLF9, BTEB, BTEB1, Krueppel-like factor 9, GC-box-binding protein 1, Basic transcription element-binding protein 1, Transcription factor BTEB1)

Sign In for Pricing
View Details
KLF9, NT (KLF9, BTEB, BTEB1, Krueppel-like factor 9, GC-box-binding protein 1, Basic transcription element-binding protein 1, Transcription factor BTEB1)
MBS645107-02 5x 0.2 mL

KLF9, NT (KLF9, BTEB, BTEB1, Krueppel-like factor 9, GC-box-binding protein 1, Basic transcription element-binding protein 1, Transcription factor BTEB1)

Sign In for Pricing
View Details