Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Turkey astrovirus 2 Non-structural polyprotein 1AB (ORF1)

This Recombinant Turkey astrovirus 2 Non-structural polyprotein 1AB (ORF1) spans the amino acid sequence from region 1052-1638.

Product Specifications

Product Name Alternative

Non-structural polyprotein 1AB, Cleaved into the following 5 chains:, 1. Protein p19, 2. Transmembrane protein 1A, 3. Serine protease p27, 4. p27, EC= 5. 3.4.21.-, 6. Protein p20, 7. RNA-directed

UniProt

Q9ILI5

Expression Region

1052-1638

Origin

Turkey astrovirus 2 (TAstV-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QRKPRACKWCGSSQKHDYRECRFQREKRFCVYCAAMHSMFEGHIRPIECTSCKKSFSGIE KLEDHVVSGECQKKLIEGPVTTKAPTPVPDWLKIFAWEDDILPPEGKTALPENVTLIGHI PVDKLVSRTKKVQDPLLGLVTPWKQDMYDSTTWTVKAYTKMFEKFHYHDPVDFVEQYAEF VLLCDNMVLREHDYMANSNITPIMSTEKNVNSTPAYPKFQAYDSEAEYLEDCGWQEYLDV VSDPETINRRPLWWCFLKNEVLKREKIEDSDIRMILCTDPIFTRIGAMFEQDQNNRMKQQ TEIRSAQVGWTPFFGGLDRRVRRLYGDGDRYFVEMDWTRYDGTIPKSLFWRIRQIRFFFL HDSHKTPKMRRLYNWYVKNLLEKIILLPTGEVCQVKKGNPSGQFSTTVDNNMINVWLTTF EVSYLFFKQRGRLPTEKELQENCSMICYGDDRLLSIRKGFVEYEPDTVIDMYKNIFGMWV KRNNIKIQDTPEGLSFCGLTIVKSSTGAYVGVPNVNKILSTLENPVRRLPDVESLWGKLV SLRILCENAPSNVKHFLDEQISNVEEFAARENIQLPEVGPDFYSRIW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUNDC1 (NM_173794) Human 3' UTR Clone
SC207493 10 µg

FUNDC1 (NM_173794) Human 3' UTR Clone

Sign In for Pricing
View Details
Pipette Tip, Robotic tip, 300ul Hamilton robotic tip, rack, sterile,96pcs/rack, 30racks/case
PLAPGRT300HSA 2880 Pieces/Case:96 Pieces/ PACKS:30 PACKS/CASE

Pipette Tip, Robotic tip, 300ul Hamilton robotic tip, rack, sterile,96pcs/rack, 30racks/case

Sign In for Pricing
View Details
MT-ND1 Antibody, HRP conjugated
A29035-100UG 100 µg

MT-ND1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Granulocyte Macrophage Colony Stimulating Factor (GM-CSF, Burst Promoting Activity, CMCSF, Colony Stimulating Factor 2, CSF Alpha, Eosinophil Colony Stimulating Factor, Granulocyte Macrophage Colony Stimulating Factor, Molgramostin, Pluripoietin Alpha, Sargramostim) (Biotin)
G8951-10I 50 µg

Granulocyte Macrophage Colony Stimulating Factor (GM-CSF, Burst Promoting Activity, CMCSF, Colony Stimulating Factor 2, CSF Alpha, Eosinophil Colony Stimulating Factor, Granulocyte Macrophage Colony Stimulating Factor, Molgramostin, Pluripoietin Alpha, Sargramostim) (Biotin)

Sign In for Pricing
View Details
SNRK Peptide - middle region
MBS3237638-01 0.1 mg

SNRK Peptide - middle region

Sign In for Pricing
View Details
SNRK Peptide - middle region
MBS3237638-02 5x 0.1 mg

SNRK Peptide - middle region

Sign In for Pricing
View Details