Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae PTS system mannitol-specific EIICB component (mtlA)

This Recombinant Streptococcus pneumoniae PTS system mannitol-specific EIICB component (mtlA) spans the amino acid sequence from region 1-589.

Product Specifications

Product Name Alternative

PTS system mannitol-specific EIICB component, EIICB-Mtl, EII-Mtl, Including the following 2 domains:, Mannitol permease IIC component, PTS system mannitol-specif

UniProt

Q8DR34

Expression Region

1-589

Origin

Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEKVSLKVRVQKLGTSLSNMVMPNIGAFIAWGVLTALFIADGYLPNEQLATVVGPMLTY LLPILIGYTGGYMIHGQRGAVVGSIATVGAITGSSVPMFIGAMVMGPLGGWTIKKFDEKF QEKIRPGFEMLVNNFSAGLVGFALLLLAFYAIGPVVSTLTGAVGNGVEAIVNARLLPMAN IIIEPAKVLFLNNALNHGIFTPLGVEQVAQAGKSILFLLEANPGPGLGILLAYAVFGKGS AKSSSWGAMVIHFFGGIHEIYFPYVMMKPTLFLAAMAGGISGTFTFQLLDAGLKSPASPG SIIAIMATAPKGVWPHLNILLGVLVAAVVSFLIAALILHADKSTEDSLEAAQAATQAAKA QSKGQLVSTSVDAVVSTDSVEKIIFACDAGMGSSAMGASILRDKVKKAGLELPVSNQAIS NLLDTPKTLIVTQEELTPRAKDKSPSAIHVSVDNFLASPRYDEIVASLTGASPIAEIEGD IPTSAPVDSQEIDLNHIDAVVVAYGKAQGTATMGCETIRAIFRNKNIRIPVSTAKISELG EFNSKNIMIVTTISLQAEVQQAAPNSQFLIVDSLVTTPEYDKMAARMYK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Major Basic Protein (MBP)
RPU54616-01 50 µg

Recombinant Mouse Major Basic Protein (MBP)

Sign In for Pricing
View Details
Recombinant Mouse Major Basic Protein (MBP)
RPU54616-02 100 µg

Recombinant Mouse Major Basic Protein (MBP)

Sign In for Pricing
View Details
Recombinant Mouse Major Basic Protein (MBP)
RPU54616-03 1 mg

Recombinant Mouse Major Basic Protein (MBP)

Sign In for Pricing
View Details
CASP3, cleaved (Asp175) (CASP3, CPP32, Caspase-3, Apopain, Cysteine protease CPP32, Protein Yama, SREBP cleavage activity 1, Caspase-3 subunit p17, Caspase-3 subunit p12) (Biotin) discontinued
033203-Biotin 200 µL

CASP3, cleaved (Asp175) (CASP3, CPP32, Caspase-3, Apopain, Cysteine protease CPP32, Protein Yama, SREBP cleavage activity 1, Caspase-3 subunit p17, Caspase-3 subunit p12) (Biotin) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal HLA-E Antibody (3D12) [Alexa Fluor 647]
NBP2-76812AF647 0.1 mL

Mouse Monoclonal HLA-E Antibody (3D12) [Alexa Fluor 647]

Sign In for Pricing
View Details
HSPBAP1 CRISPRa sgRNA lentivector (set of three targets)(Human)
24024121 3x 1.0µg DNA

HSPBAP1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details