Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant PTS system mannitol-specific EIICB component (mtlA)

This Recombinant PTS system mannitol-specific EIICB component (mtlA) spans the amino acid sequence from region 1-589.

Product Specifications

Product Name Alternative

PTS system mannitol-specific EIICB component, EIICB-Mtl, EII-Mtl, Including the following 2 domains:, Mannitol permease IIC component, PTS system mannitol-specif

UniProt

Q9KJ75

Expression Region

1-589

Origin

Streptococcus mutans

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERKSSLKVRVQKLGTSLSNMVMPNIGAFIAWGVAASLFIATGYLPNKALDTNVVGPMLK YVLPLLIGYTGGYNIHKQRGGVIGAIASFGAIAGSTVTMFIGAMIMGPLSAWILKKFDEK VQPKIRTGFEMLVNNFSLGLIGFALMVLAFFVIGPVVAQLTEWVGIGVEAIVKVHLLPLA NLIIEPAKILFLNNALNHGIFTPLGTEQVAKVGKSVLFLLEANPGPGLGVLIAYAMFGKG SAKSSSWGAMIIHFFGGIHEIYFPYVMMKPAMFLAVIAGGLTGTFTFQTLGAGLTAPASP GSIIAIMGMSPKGWGPHLVVLAGVFAAAVASFLVASIILKSDNSDDDSLETAQAVTQAAK AESKGQAVTEPNLHSDITTDNIHQIIFACDAGMGSSAMGASILRDKVKKAGLDISVSNQA ISNLQDTANTLIVTQEELADRAGQKTPRAVHVAVDNFLATSKYDDIIASLTNGKASGSEN AAHSTQADSAEIDLNQIDAVVFAYGIAKGSATMGQETLRSIFKQNNVKIPVSTASYAHLS DYNAKNILLVTTIAQQGQAQQAAPNAQILVVDSLVTTPEYDKLVARMHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine Polymeric immunoglobulin receptor(PIGR), partial
AP70634-01 20 µg

Recombinant Bovine Polymeric immunoglobulin receptor(PIGR), partial

Sign In for Pricing
View Details
Recombinant Bovine Polymeric immunoglobulin receptor(PIGR), partial
AP70634-02 100 µg

Recombinant Bovine Polymeric immunoglobulin receptor(PIGR), partial

Sign In for Pricing
View Details
Recombinant Bovine Polymeric immunoglobulin receptor(PIGR), partial
AP70634-03 1 mg

Recombinant Bovine Polymeric immunoglobulin receptor(PIGR), partial

Sign In for Pricing
View Details
PDGFRA (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a, MGC74795) (Biotin)
MBS6143459-01 0.1 mL

PDGFRA (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a, MGC74795) (Biotin)

Sign In for Pricing
View Details
PDGFRA (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a, MGC74795) (Biotin)
MBS6143459-02 5x 0.1 mL

PDGFRA (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a, MGC74795) (Biotin)

Sign In for Pricing
View Details
EZH1 (NM_001991) Human Recombinant Protein
E45H40905M5 20 µg

EZH1 (NM_001991) Human Recombinant Protein

Sign In for Pricing
View Details