Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Silicibacter sp. Membrane protein insertase YidC (yidC)

This Recombinant Silicibacter sp. Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-608.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q1GJX6

Expression Region

1-608

Origin

Silicibacter sp. (strain TM1040)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDDQNKNLLLATALSFLVILGWYFFFPPPEEAPQPATEVTETAPQGDTTAPAAAPSAGAA TAEVDAAAAETEITEDVPRLTIDTPRVEGSISLKGGRIDDLRLKDYRETLDDDSPIVTLL SPAGQPHAYYALYGWAPGAGLGIEDVPTANTLWQAEAGATLTPDTPVTLTWDNGKGLTFS REVSIDEDYMFSITQSVTNSSGASVALAPYGTLARHGEPANLENFFVLHEGVVGMADGEL SEIDYDDMTDFDPDPRDGSRAQVNTVTENGWIGFTGHYWMSTLIPAPGEAFRAIAKYDER RDIYQTDVVLPTVTLAAGESTSANTQLFAGAKEWATIREYERAGIEGFLDSIDWGWFFFF TKPIFAVLHWLNAAIGNMGVAIIALTFLLKILVFPLAYKSYASMARMKELQPEMEKLRER AGDDRQKMQKEMMELYKREKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAAFFGPFQ DLSVPDPTSLFNLFGLLPWAAPAPDSLLSLVFIGILPILLGVSMWVQQKLNPAPTDETQR MIFAWMPWVFMFMLGGFASGLVVYWITNNVITFTQQYLIMRSHGYTPDVFGNIKSGFKKD KAEKAEKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Synechococcus sp. NAD (P)H-quinone oxidoreductase subunit 3 (ndhC), partial
MBS7092885 Inquire

Recombinant Synechococcus sp. NAD (P)H-quinone oxidoreductase subunit 3 (ndhC), partial

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Rat IgG2b Secondary Antibody [Janelia Fluor 549]
NBP2-68490JF549 0.5 mL

Goat Polyclonal Goat anti-Rat IgG2b Secondary Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
NEK9 (Serine/Threonine-protein Kinase Nek9, Nercc1 Kinase, Never in Mitosis A-related Kinase 9, NimA-related Protein Kinase 9, NimA-related Kinase 8, Nek8, KIAA1995, NEK8, NERCC, DKFZp434D0935, MGC138306, MGC16714, NERCC1) (MaxLight 750)
MBS6234105-01 0.1 mL

NEK9 (Serine/Threonine-protein Kinase Nek9, Nercc1 Kinase, Never in Mitosis A-related Kinase 9, NimA-related Protein Kinase 9, NimA-related Kinase 8, Nek8, KIAA1995, NEK8, NERCC, DKFZp434D0935, MGC138306, MGC16714, NERCC1) (MaxLight 750)

Sign In for Pricing
View Details
NEK9 (Serine/Threonine-protein Kinase Nek9, Nercc1 Kinase, Never in Mitosis A-related Kinase 9, NimA-related Protein Kinase 9, NimA-related Kinase 8, Nek8, KIAA1995, NEK8, NERCC, DKFZp434D0935, MGC138306, MGC16714, NERCC1) (MaxLight 750)
MBS6234105-02 5x 0.1 mL

NEK9 (Serine/Threonine-protein Kinase Nek9, Nercc1 Kinase, Never in Mitosis A-related Kinase 9, NimA-related Protein Kinase 9, NimA-related Kinase 8, Nek8, KIAA1995, NEK8, NERCC, DKFZp434D0935, MGC138306, MGC16714, NERCC1) (MaxLight 750)

Sign In for Pricing
View Details
FT-1518 1mg
A19230-1 1 mg

FT-1518 1mg

Sign In for Pricing
View Details
Recombinant Anti-CD36 Antibody, Rabbit Monoclonal
MBS8103789-01 0.1 mL

Recombinant Anti-CD36 Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details