Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia typhi Uncharacterized protein RT0031 (RT0031)

This Recombinant Rickettsia typhi Uncharacterized protein RT0031 (RT0031) spans the amino acid sequence from region 25-674.

Product Specifications

Product Name Alternative

Uncharacterized protein RT0031

UniProt

Q68XX3

Expression Region

25-674

Origin

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GFGESCSNLPITSDGYLETYTAYGYIIRSIDMKDPRGNCNPYTSSITFCFKNVEGSTSPC TIYTLNEGDARKISDLSTDNNPNLGANTVLKNIVLTVKKFGNDLCLAMPTSRGPMPVACK SLNATPAPTNPKYENCNIGKSCYTGANYSQSLINFSGLAVQCLSETLNKIFFTGNSCSSQ DQNSRITHLAAFSTFQGYLKRIIGAALILYTMFFAFNMALNKEYATTEKITLFIIKFLFV VYFSIGLEPLNFSGGQTVKENGMLKYGLPLLTGAAPDFAEMIFNAAGSRGLCQFDNSKYK DGYKFYGLWDAIDCRIGYYLGLDLLYNIDKNGILGHSVGNGPGGNNKPIPNFDPDSKKDR PHDLSKAGALRFFTVMFGFLMSGHIIILVAGIAFSVIFLSILLYFITHYLVCMITIYVMT YISPIFIPMVLFTRTKAYFDGWVKVCISCALQPAVVAGFIALLITMYDSAIFKNCEFLRY DYEKGDIRFSTFELRLPSIDADKCQESFGYKMLKYYAGEGWEEHLLILFPIKSIVRDVVS ILAELLCVLVFSVIFYYFSKSIGRFAADLTNGPNMDAVTASPTKIVDLVKKGAAFLQDAS SVHAQGKSPVEDKPDIGSKRKDGVQQGEDSENSSGGELADLASGSGGGKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clusterin alpha (Clusterin, Aging-Associated Gene 4 Protein, Apolipoprotein J, Apo-J, Complement cytolysis Inhibitor, CLI, Complement-Associated Protein SP-40,40, Ku70-Binding Protein 1, NA1/NA2, Testosterone-repressed Prostate message 2, TRPM-2, Clusterin beta Chain, ApoJalpha, Complement cytolysis Inhibitor a Chain, Clusterin alpha Chain, ApoJbeta, Complement cytolysis Inhibitor b Chain, CLU, APOJ, CLI, KUB1, ORF Names: AAG4) discontinued
221775-01 50 µL

Clusterin alpha (Clusterin, Aging-Associated Gene 4 Protein, Apolipoprotein J, Apo-J, Complement cytolysis Inhibitor, CLI, Complement-Associated Protein SP-40,40, Ku70-Binding Protein 1, NA1/NA2, Testosterone-repressed Prostate message 2, TRPM-2, Clusterin beta Chain, ApoJalpha, Complement cytolysis Inhibitor a Chain, Clusterin alpha Chain, ApoJbeta, Complement cytolysis Inhibitor b Chain, CLU, APOJ, CLI, KUB1, ORF Names: AAG4) discontinued

Sign In for Pricing
View Details
Clusterin alpha (Clusterin, Aging-Associated Gene 4 Protein, Apolipoprotein J, Apo-J, Complement cytolysis Inhibitor, CLI, Complement-Associated Protein SP-40,40, Ku70-Binding Protein 1, NA1/NA2, Testosterone-repressed Prostate message 2, TRPM-2, Clusterin beta Chain, ApoJalpha, Complement cytolysis Inhibitor a Chain, Clusterin alpha Chain, ApoJbeta, Complement cytolysis Inhibitor b Chain, CLU, APOJ, CLI, KUB1, ORF Names: AAG4) discontinued
221775-02 100 µL

Clusterin alpha (Clusterin, Aging-Associated Gene 4 Protein, Apolipoprotein J, Apo-J, Complement cytolysis Inhibitor, CLI, Complement-Associated Protein SP-40,40, Ku70-Binding Protein 1, NA1/NA2, Testosterone-repressed Prostate message 2, TRPM-2, Clusterin beta Chain, ApoJalpha, Complement cytolysis Inhibitor a Chain, Clusterin alpha Chain, ApoJbeta, Complement cytolysis Inhibitor b Chain, CLU, APOJ, CLI, KUB1, ORF Names: AAG4) discontinued

Sign In for Pricing
View Details
Human Thioredoxin-1/Trx1 ELISA Kit
E100301 1 Each

Human Thioredoxin-1/Trx1 ELISA Kit

Sign In for Pricing
View Details
Isocorybulbine
HY-N11827 1 Each

Isocorybulbine

Sign In for Pricing
View Details
Lentiviral mouse Phc2 shRNA (UAS) - Lentiviral mouse Phc2 shRNA (UAS) (25)
GTR15259025 1 Vial

Lentiviral mouse Phc2 shRNA (UAS) - Lentiviral mouse Phc2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Recombinant Human RPP25 Protein, N-His
ARO-P12693-01 50 µg

Recombinant Human RPP25 Protein, N-His

Sign In for Pricing
View Details