Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Superoxide-generating NADPH oxidase heavy chain subunit B (noxB)

This Recombinant Dictyostelium discoideum Superoxide-generating NADPH oxidase heavy chain subunit B (noxB) spans the amino acid sequence from region 1-698.

Product Specifications

Product Name Alternative

Superoxide-generating NADPH oxidase heavy chain subunit B, EC= 1.-.-.-, NADPH oxidase B, Superoxide-generating NADPH oxidase flavocytochrome B

UniProt

Q86GL4

Expression Region

1-698

Origin

Dictyostelium discoideum (Slime mold)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEKKELQQELELQEFQTPKNQQLEKLQEPNGEISSTGNETSESGISSPPISQNDNSNNE NESLNITPNKPFVSMQEELQNLDIENIPIPPTIQTPKIYKNTNNLIHSKNNLSLPISLSQ ENIVKLDKVDIESNDQVNSNTDNNNNTNNNNNTNNNKNEKIGLRSKIFKSKIFIKIRGWW WHRGISTYIMLFYIALNIGVGVHMFYNMYHSDIFKFLGLSFCFSRTAARLINLNSAVILL PVLRNFLSWLRGTIVNNYIPIDKHLNFHKLCAFMLFCCTIIHCVGHYISFKKINDDVLKI DDGKSVAGDYLNININNFPDEKYLFFKSVPGITGHIMLLILILIVSSSMWRIRRPMFEIF WYVHHLFIPFYILLCFHGYSKILKKDPQSWMWIIAPFILYSIERLIRIARSKKRVILEKA IMHPSKVLELRMKRDNDNFNFKPGQYLYLNCPSIAYHEWHPFTITSAPDDPFISVHINIV GNWTRKLFKLLNPDNKLGLIQEDLKSTQNRGKRRILKIDGPFGAPAENFFKYRNLVLIGA GIGVTPFSSILRHLKNQNDKQTNADENHLKINKIYFIWISRQKNSFQWFTDILAELENDE RIDSILEIHIFLTGALELDDYAKIKNAQKCHITNLHSKTLFGRPNFRSIFNQLTQLHQRE KIGVFYCGNKALGKNIIKNCNKFNGKNNCHLIFHKENF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT19 ELISA Kit (Human) (OKCD07247)
OKCD07247 96 Well

KRT19 ELISA Kit (Human) (OKCD07247)

Sign In for Pricing
View Details
RAD18 (Postreplication Repair Protein hRAD18p, Postreplication Repair Protein RAD18, RAD18 Homolog, RAD18 (S. cerevisiae) Homolog, RING Finger Protein 73, RNF73) discontinued
212981-01 20 µL

RAD18 (Postreplication Repair Protein hRAD18p, Postreplication Repair Protein RAD18, RAD18 Homolog, RAD18 (S. cerevisiae) Homolog, RING Finger Protein 73, RNF73) discontinued

Sign In for Pricing
View Details
RAD18 (Postreplication Repair Protein hRAD18p, Postreplication Repair Protein RAD18, RAD18 Homolog, RAD18 (S. cerevisiae) Homolog, RING Finger Protein 73, RNF73) discontinued
212981-02 100 µL

RAD18 (Postreplication Repair Protein hRAD18p, Postreplication Repair Protein RAD18, RAD18 Homolog, RAD18 (S. cerevisiae) Homolog, RING Finger Protein 73, RNF73) discontinued

Sign In for Pricing
View Details
TMED3 (C15orf22, Transmembrane emp24 Domain-containing Protein 3, Membrane Protein p24B, p24 Family Protein gamma-4, p26, p24gamma4, UNQ5357/PRO1078, MGC133022) (MaxLight 650)
MBS6403020-01 0.1 mL

TMED3 (C15orf22, Transmembrane emp24 Domain-containing Protein 3, Membrane Protein p24B, p24 Family Protein gamma-4, p26, p24gamma4, UNQ5357/PRO1078, MGC133022) (MaxLight 650)

Sign In for Pricing
View Details
TMED3 (C15orf22, Transmembrane emp24 Domain-containing Protein 3, Membrane Protein p24B, p24 Family Protein gamma-4, p26, p24gamma4, UNQ5357/PRO1078, MGC133022) (MaxLight 650)
MBS6403020-02 5x 0.1 mL

TMED3 (C15orf22, Transmembrane emp24 Domain-containing Protein 3, Membrane Protein p24B, p24 Family Protein gamma-4, p26, p24gamma4, UNQ5357/PRO1078, MGC133022) (MaxLight 650)

Sign In for Pricing
View Details
Human ADORA2A full length protein-MNP
MBS189776-01 0.05 mg

Human ADORA2A full length protein-MNP

Sign In for Pricing
View Details