Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium halobium Bacteriorhodopsin (bop)

This Recombinant Halobacterium halobium Bacteriorhodopsin (bop) spans the amino acid sequence from region 1-204.

Product Specifications

Product Name Alternative

Bacteriorhodopsin, BR

UniProt

P33969

Expression Region

1-204

Origin

Halobacterium halobium (strain mex)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GIGTLLMLIGTFYFIARGWGVTDKKAREYYAITILVPGIASAAYLSMFFGIGLTTVEVAG MAEPLEIYYARYADWLFTTPLLLLDLALLANADRTTIGTLIGVDALMIVTGLIGALSHTP LARYTWWLFSTIAFLFVLYYLLTVLRSAAAELSEDVQTTFNTLTALVAVLWTAYPILWII GTEGAGVVGLGVETLAFMVLDVTA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKappaB-p105/p50 Polyclonal Antibody
BT-AP05981-01 20 µL

NFKappaB-p105/p50 Polyclonal Antibody

Sign In for Pricing
View Details
NFKappaB-p105/p50 Polyclonal Antibody
BT-AP05981-02 50 µL

NFKappaB-p105/p50 Polyclonal Antibody

Sign In for Pricing
View Details
NFKappaB-p105/p50 Polyclonal Antibody
BT-AP05981-03 100 µL

NFKappaB-p105/p50 Polyclonal Antibody

Sign In for Pricing
View Details
SLC25A21 (Mitochondrial 2-oxodicarboxylate Carrier, Solute Carrier Family 25 Member 21, ODC) (MaxLight 650)
MBS6224691-01 0.1 mL

SLC25A21 (Mitochondrial 2-oxodicarboxylate Carrier, Solute Carrier Family 25 Member 21, ODC) (MaxLight 650)

Sign In for Pricing
View Details
SLC25A21 (Mitochondrial 2-oxodicarboxylate Carrier, Solute Carrier Family 25 Member 21, ODC) (MaxLight 650)
MBS6224691-02 5x 0.1 mL

SLC25A21 (Mitochondrial 2-oxodicarboxylate Carrier, Solute Carrier Family 25 Member 21, ODC) (MaxLight 650)

Sign In for Pricing
View Details
Mmu-miR-206-5p miRNA Agomir
CMN0855-01 5 nmol

Mmu-miR-206-5p miRNA Agomir

Sign In for Pricing
View Details