Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium halobium Bacteriorhodopsin (bop)

This Recombinant Halobacterium halobium Bacteriorhodopsin (bop) spans the amino acid sequence from region 1-204.

Product Specifications

Product Name Alternative

Bacteriorhodopsin, BR

UniProt

P33969

Expression Region

1-204

Origin

Halobacterium halobium (strain mex)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GIGTLLMLIGTFYFIARGWGVTDKKAREYYAITILVPGIASAAYLSMFFGIGLTTVEVAG MAEPLEIYYARYADWLFTTPLLLLDLALLANADRTTIGTLIGVDALMIVTGLIGALSHTP LARYTWWLFSTIAFLFVLYYLLTVLRSAAAELSEDVQTTFNTLTALVAVLWTAYPILWII GTEGAGVVGLGVETLAFMVLDVTA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MEKK3 Antibody
NBP2-17273 0.1 mL

Rabbit Polyclonal MEKK3 Antibody

Sign In for Pricing
View Details
RGD1310429 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV645168 1.0 µg DNA

RGD1310429 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
PDE1B, CT (PDE1B, PDE1B1, PDES1B, Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B, 63kD Cam-PDE) (PE) discontinued
039800-PE 200 µL

PDE1B, CT (PDE1B, PDE1B1, PDES1B, Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B, 63kD Cam-PDE) (PE) discontinued

Sign In for Pricing
View Details
Anti-PRSS44 Antibody Picoband®, Cy3 Conjugate
A18279-1-Cy3 100 µg/Vial

Anti-PRSS44 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Bovine Respiratory Syncytial Virus, BRSV ELISA KIT
ED0009Bo-01 96 Well

Bovine Respiratory Syncytial Virus, BRSV ELISA KIT

Sign In for Pricing
View Details
Bovine Respiratory Syncytial Virus, BRSV ELISA KIT
ED0009Bo-02 5x 96 Tests

Bovine Respiratory Syncytial Virus, BRSV ELISA KIT

Sign In for Pricing
View Details