Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium halobium Bacteriorhodopsin (bop)

This Recombinant Halobacterium halobium Bacteriorhodopsin (bop) spans the amino acid sequence from region 1-204.

Product Specifications

Product Name Alternative

Bacteriorhodopsin, BR

UniProt

P33969

Expression Region

1-204

Origin

Halobacterium halobium (strain mex)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GIGTLLMLIGTFYFIARGWGVTDKKAREYYAITILVPGIASAAYLSMFFGIGLTTVEVAG MAEPLEIYYARYADWLFTTPLLLLDLALLANADRTTIGTLIGVDALMIVTGLIGALSHTP LARYTWWLFSTIAFLFVLYYLLTVLRSAAAELSEDVQTTFNTLTALVAVLWTAYPILWII GTEGAGVVGLGVETLAFMVLDVTA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Morpholino C phosphoramidite
TSW-01156-01 10 mg

Morpholino C phosphoramidite

Sign In for Pricing
View Details
Morpholino C phosphoramidite
TSW-01156-02 50 mg

Morpholino C phosphoramidite

Sign In for Pricing
View Details
COL12A1 siRNA (m)
sc-72959 10 µM

COL12A1 siRNA (m)

Sign In for Pricing
View Details
P27 / KIP1 (DCS-72.F6), CF405S conjugate, 0.1mg/mL
BNC040771-500 1x 500 µL

P27 / KIP1 (DCS-72.F6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MTA1 (Metastasis Associated 1) (FITC)
248984-FITC 100 µL

MTA1 (Metastasis Associated 1) (FITC)

Sign In for Pricing
View Details
Recombinant Human IL12B protein, No tag
IMP-1121 10 µg

Recombinant Human IL12B protein, No tag

Sign In for Pricing
View Details