Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium halobium Bacteriorhodopsin (bop)

This Recombinant Halobacterium halobium Bacteriorhodopsin (bop) spans the amino acid sequence from region 1-209.

Product Specifications

Product Name Alternative

Bacteriorhodopsin, BR

UniProt

P33972

Expression Region

1-209

Origin

Halobacterium halobium (strain shark)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LWLGTAGMFLGMLYFIARGWGETDGRRQKFYIATILITAIAFVNYLAMALGFGLTFIEFG GEQHPIYWARYTDWLFTTPLLLYDLGLLAGADRNTIYSLVSLDVLMIGTGVVATLSAGSG VLSAGAERLVWWGISTAFLLVLLYFLFSSLSGRVANLPSDTRSTFKTLRNLVTVVWLVYP VWWLVGSEGLGLVGIGIETAGFMVIDLVA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gene Mutation Detection Kit for Well differentiated adenocarcinoma (E(L858R); K(-) Mutation)
MLEL858-184 1 Kit

Gene Mutation Detection Kit for Well differentiated adenocarcinoma (E(L858R); K(-) Mutation)

Sign In for Pricing
View Details
RILPL1 Antibody - N-terminal
OAPB01478-100UG 0.1 mg

RILPL1 Antibody - N-terminal

Sign In for Pricing
View Details
PerCP/Cyanine5.5 anti-human CD56 (NCAM) Recombinant
GT16806 25 Tests

PerCP/Cyanine5.5 anti-human CD56 (NCAM) Recombinant

Sign In for Pricing
View Details
Triphenylbismuth
sc-280160B 100 g

Triphenylbismuth

Sign In for Pricing
View Details
NCAM1 Protein Vector (Rat) (pPM-C-HA)
PV284476 500 ng

NCAM1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
RPS6 Protein Vector (Rat) (pPM-C-His)
PV302493 500 ng

RPS6 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details